KEGG   Takifugu rubripes (torafugu): 101062631Help
Entry
101062631         CDS       T02386                                 

Gene name
ndufs3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00190  Oxidative phosphorylation
tru01100  Metabolic pathways
Module
tru_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101062631 (ndufs3)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101062631 (ndufs3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101062631 (ndufs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 101062631
NCBI-ProteinID: XP_003969800
Ensembl: ENSTRUG00000014669
UniProt: H2UKK8
Position
13
AA seq 260 aa AA seqDB search
MAASLVRFVRGGLGRSINVARSSCVLQQHKRLQSSTSDTQPTVRPKDAVIHKQLAAFGEY
VSEMLPKYIQQVQVTCYDELEVMIHPDGVVPVLTFLRDHTNAQFRNMIDLTAVDIPTRQN
RFEIVYNLLSLRYNSRIRVKTYTDELTPVDSAVPVHIAANWYEREVWDMFGVFFANHPDL
RRILTDYGFEGHPFRKDFPLSGYVEVRYDDEVKRVVAEPLELSQEFRKFDLNTPWEVFPA
HREAKEAAPKLEAGETPEKK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcattagtgcggtttgtccgcgggggtcttggaaggagtattaacgttgca
agatcttcgtgtgtactccagcagcacaaaagactgcagagctctacatctgacactcaa
cccactgtcaggcccaaagatgctgtcattcacaaacagctggctgcatttggggagtat
gtttccgaaatgctgccaaaatatatccagcaggtccaggtgacctgctacgatgagctg
gaggtgatgatccatcctgatggagtcgtacctgttctgaccttcctgagggaccatacc
aatgctcagttcaggaacatgattgatctgactgctgttgacatcccaacacgccagaac
cgctttgagatcgtttacaacctgctgtcactacgctataactctcgtattcgtgtcaag
acctacacggatgagctgacacccgtggactcggcagtcccagtccacattgctgccaac
tggtatgagagggaggtgtgggacatgtttggtgtgttcttcgctaaccatccagacctg
aggcgcatccttacagactacgggttcgaaggtcatcccttcaggaaggacttccccctc
tctggatacgtagaggtgcgttatgatgacgaggtgaagcgtgtggtggctgagcccctt
gagctgtcgcaggagttcaggaagtttgatctgaacacaccctgggaagtttttccagca
catcgcgaggccaaagaggctgcgcccaaactggaggccggcgagacccccgaaaaaaag
tga

DBGET integrated database retrieval system