KEGG   Takifugu rubripes (torafugu): 101062935Help
Entry
101062935         CDS       T02386                                 

Gene name
prkacb
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04020  Calcium signaling pathway
tru04114  Oocyte meiosis
tru04140  Autophagy - animal
tru04261  Adrenergic signaling in cardiomyocytes
tru04270  Vascular smooth muscle contraction
tru04310  Wnt signaling pathway
tru04340  Hedgehog signaling pathway
tru04371  Apelin signaling pathway
tru04530  Tight junction
tru04540  Gap junction
tru04910  Insulin signaling pathway
tru04912  GnRH signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04916  Melanogenesis
Module
tru_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101062935 (prkacb)
   04310 Wnt signaling pathway
    101062935 (prkacb)
   04340 Hedgehog signaling pathway
    101062935 (prkacb)
   04371 Apelin signaling pathway
    101062935 (prkacb)
   04020 Calcium signaling pathway
    101062935 (prkacb)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101062935 (prkacb)
  Cell growth and death
   04114 Oocyte meiosis
    101062935 (prkacb)
  Cellular community - eukaryotes
   04530 Tight junction
    101062935 (prkacb)
   04540 Gap junction
    101062935 (prkacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101062935 (prkacb)
   04912 GnRH signaling pathway
    101062935 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    101062935 (prkacb)
   04916 Melanogenesis
    101062935 (prkacb)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101062935 (prkacb)
   04270 Vascular smooth muscle contraction
    101062935 (prkacb)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101062935 (prkacb)
Protein kinases [BR:tru01001]
 Serine/threonine kinases: AGC group
  PKA family
   101062935 (prkacb)
Messenger RNA biogenesis [BR:tru03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101062935 (prkacb)
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101062935 (prkacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101062935
NCBI-ProteinID: XP_003974336
Position
20
AA seq 377 aa AA seqDB search
MAQGSFASRIFHKYCKNSQEHREPDSEVPHISEFTTMWEKLMKEFLAKAKEDFLRKWECP
QQCTTGLDDFDRFKTLGTGSFGRVMLVKHKETNQFYAMKILDKQKVVKLKQIEHTLNEKR
ILQAVSFPFLVRLVYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEHHARFYAAQIILT
FEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSK
GYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLL
QVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYEKKVEAPFLPKCRGPGDTSNFDDYEEE
DVHVSQTEKCAKEFADF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcccagggatcgtttgccagccgcattttccacaaatactgtaagaatagccaagag
cacagagaaccagacagtgaggtgcctcacatttcagagttcaccaccatgtgggagaag
ctgatgaaagagttcttagctaaagccaaagaagattttttaagaaaatgggagtgtcct
cagcagtgcacaacaggcctggatgatttcgacaggttcaagactctgggaaccggctcc
tttggcagagtgatgctcgtcaaacacaaagaaacaaaccagttctatgcgatgaagatc
ttggacaaacaaaaagtggttaagttgaagcagatagaacacacattaaatgaaaagaga
atactacaggcggtctctttccctttcctcgtcagactggtctactctttcaaggacaac
tctaatctctacatggtgatggaatatgtgcccggtggggagatgttctcgcacctcaga
cgtattggaagattcagtgaacaccatgcaagattttatgcggctcagattatactgacc
tttgagtaccttcactccctggacctcatctacagagacctgaagcctgaaaacctgctc
atagatcagcaggggtatattcaggttacagactttggatttgccaaaagagtaaaaggt
cgaacctggacgttgtgtggaactccagagtacctggctccagagatcatccttagcaag
ggctacaacaaagctgtggactggtgggccctcggagttcttatctacgaaatggctgct
ggttaccctcctttttttgccgatcagcccatccagatctacgaaaagatcgtgtctggc
aaggtacgatttccctcccactttagctccgacttgaaggatctgctgaggaacctgctg
caggttgacctgacgaaaagatttggcaacctgaagaacggcgtgaacgacatcaaaaac
cacaagtggttctccacaacagattggatcgccatatatgagaaaaaggtggaagcgcct
tttttgccaaagtgccgaggacccggagacacgagtaacttcgatgattacgaagaggag
gatgttcacgtctcgcagacggaaaagtgcgcgaaagagtttgctgatttttag

DBGET integrated database retrieval system