KEGG   Takifugu rubripes (torafugu): 101063405Help
Entry
101063405         CDS       T02386                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101063405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tru03041]
    101063405
Enzymes [BR:tru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     101063405
Spliceosome [BR:tru03041]
 Complex C
  Other components
   Step II factors
    101063405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 AAA_30 Flavi_DEAD ABC_tran PhoH AAA_16 Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 101063405
NCBI-ProteinID: XP_029701023
Position
1
AA seq 1206 aa AA seqDB search
MMADISVDELQQLEYLSLVSKVCTELDNHLGLNDKDLAEFVIHLAEKQPTFDGFKALLIQ
NGAEFTDSLISNLLRLIQTMRPPTKAGTSPASEASVQPKTRKEKLKEMFPALCRANDPAP
EKLLDEDDVKVAADAMKELEMFLPSVSGTDPKTSRSSRSEKSRRCSRSRSRSRERDRHRD
RDREKDRKRTRRSRSRSRDRERCRERERGKRRDKSSRWSERSPSPRRERDPDRWKDKHVE
RPPPEEPSVGDIYCGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVRK
GQRVKVKVLSFTGSKTSLSMKDVDQETGEDLNPNRRRNVGPDGSEEVSMRNPDRPSNLNL
GHGPEVEQDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDDETGILPKVDDEED
EDLEIELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERRELKQAAR
EAEMDSIPMGLNKHWVDPLPDTDGRQIAANMRGIGMMPNDMPEWKKHAFGGNKASYGKKT
QLSILEQRESLPIYKLKEQLVQAVHENQILIVIGETGSGKTTQITQYLAEAGYTSRGKIG
CTQPRRVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDS
ELGQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRTDMKLIVTSATLDAVKFSQYFYEAPI
FTIPGRTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILY
ERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYV
VDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLT
TNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLT
RLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAK
FHQPEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVV
SCGKATVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHEL
VLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRIS
RAFRRR
NT seq 3621 nt NT seq  +upstreamnt  +downstreamnt
atgatggcggacatcagcgttgatgagctgcagcagctggagtatctttctctggtgtct
aaagtctgcacggagttggacaaccatctgggccttaatgacaaagacctcgctgaattt
gtgatccaccttgctgaaaaacaaccgacatttgacggattcaaagctctgttgatccaa
aatggagccgaattcacggattctctcatcagtaatctgctgcgactcatccagaccatg
cggcctccaaccaaagccgggaccagtccagcttcggaggcttcagtccagcccaagacc
agaaaggagaagttgaaggagatgtttcctgctctgtgtcgtgcaaatgatccagcccct
gaaaaacttttagatgaagatgatgtgaaagtagcagctgatgccatgaaagagctggag
atgtttctgcccagtgtcagcgggacagaccccaaaaccagcaggagcagcaggtctgag
aagagcagacgttgcagtcggagtcgcagcagaagccgagagagagaccgacacagagac
cgagatcgggagaaggacaggaagaggactcgccggtcccggtcccgctccagagaccgg
gagcggtgcagggagcgagagcgcggcaaaaggagggacaagtcttcccgctggagcgag
cgctctccgagccccaggagggagcgggaccctgatcggtggaaggacaaacacgtggag
cgcccccccccggaggagccctccgtgggggacatctactgtgggaaggtcaccagcatc
atgcagtttggctgctttgtccagctggaggggctacggaaacggtgggagggcctggtc
cacatctccgagctccgccgagagggccgtgtagcaaacgtggccgacgtggtccgcaaa
ggccaacgggtcaaggtcaaggttctgtccttcacaggttccaagaccagcctcagtatg
aaggatgtggaccaggagaccggagaagacctgaatcccaacaggaggaggaatgttggc
ccggacggaagtgaggaagtctccatgaggaaccctgatcggcccagcaacctgaacctg
ggccacggccccgaggtggagcaggacgacacactggagcgaaagaggctgaccaagatc
tccgacccagagaagtgggagatcaagcagatgatcgctgccaacgtcctgtccaaggaa
gagttccccgattttgatgatgagactgggattctccctaaagtggacgatgaggaggat
gaggatctggaaattgagctggtggaagaagagccgccgttcctgaggggacacaccaag
cagagcatggacatgagtcctgtcaagatcgtcaagaatcccgatggctccctgtctcag
gccgccatgatgcagagcgccctcgccaaggagagacgggagctgaagcaggcggcccgc
gaggccgagatggactccatccccatgggactgaacaagcactgggtggacccgctgccg
gacactgacgggaggcagattgctgccaacatgagggggatcggaatgatgcccaacgac
atgccggagtggaagaaacacgcgtttgggggcaacaaggcctcgtatgggaagaagacc
cagctgtccatcctggagcagcgggagagcctgcccatctacaagctgaaggagcagctc
gtgcaggccgtccacgagaaccagatcctgattgttatcggtgagacgggctccgggaag
accacgcagatcacccagtacctggccgaggccggctacaccagcagggggaagatcggc
tgcacccagcccagacgtgtggccgccatgtctgtggccaagagggtgtctgaggagtac
ggctgctgtctgggtcaggaggtgggctacaccatccgctttgaggactgcaccagccca
gaaaccgtcatcaagtacatgacagacggaatgctgctgcgcgagtgtctgatcgactcg
gaactgggtcagtacgccatcatcatgctggacgaggcccacgagaggaccatccacacc
gacgtgctcttcgggctgctgaagaagaccgttcagaaacggaccgacatgaagctgatc
gtgacctcggccacgctggacgccgtcaagttctctcagtacttctacgaggcgcccatc
ttcaccatcccaggaagaacctacccagtggaggtgctctacaccaaagagcctgagacc
gactacctggacgccagtctgatcacagtcatgcagatccacctgacggaacctccaggc
gacatcctggtgttcctgaccggacaggaagagatcgacaccgcctgtgagatcctgtac
gagcgcatgaagtcgctggggcccgacgttcccgagctcatcatcctcccggtttattcc
gccctccccagcgagatgcagaccagaatcttcgacccggcgccgcccggcagcagaaag
gtggtcatcgccaccaacatcgccgagacctctctgaccatagacgggatctattacgtg
gtggatcccgggttcgtgaagcagaaagtctacaactccaagacgggcatcgaccagctg
gtggtgacgcccatctcccaggctcaggccaagcagagggcgggccgagctggcagaacc
ggacccgggaagtgttaccggctgtacaccgagagggcctacagagacgagatgttgacc
accaacgtgccggagatccagaggaccaacctggcgagcacggtgctgtctctgaaggcc
atgggcatcaacgacctgctgtccttcgacttcatggacgctcctcccatggagacgctg
atcacggccatggagcagctctacacgctgggagcgctggacgacgaggggctgctcacc
cggttggggaggaggatggccgagttccccctggagcccatgctgtgtaagatgctgatc
atgtccgtccacctgggctgcagcgaggagatgctgaccatcgtctccatgctgtcggtg
cagaacgtcttctacaggcccaaagacaagcaggctttggctgaccaaaagaaggcaaag
ttccaccagccggagggagaccatctgaccctgttggcagtttacaactcctggaagaac
aacaagttctccaacccctggtgctacgagaacttcatccaggctcgctcccttcgcaga
gcccaggacatccgcaaacagatgctgggaatcatggacaggcacaagcttgacgtggtg
tcctgtggcaaagcaacagtccgggtccagaaagccatctgcagtggtttcttcaggaac
gcagccaagaaggatcctcaggaaggctaccgcaccctgatcgaccagcaggtggtctac
atccacccctccagtgctctgttcaaccgccagccggagtgggtcgtctaccatgagctg
gtgctgaccaccaaggaatacatgcgggaggtgaccaccatcgacccccgctggctggtg
gagttcgcgcctgcgttctttaaggtgtccgaccccactcgcctcagcaagcagaagaag
cagcagcgcctggagcctctgtacaaccgctacgaggagcccaacgcctggaggatctcg
cgcgccttcagacgccgttga

DBGET integrated database retrieval system