KEGG   Takifugu rubripes (torafugu): 101063503Help
Entry
101063503         CDS       T02386                                 

Gene name
syk
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    101063503 (syk)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101063503 (syk)
Protein kinases [BR:tru01001]
 Non-receptor tyrosine kinases
  SYK family
   101063503 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 101063503
NCBI-ProteinID: XP_011602713
Position
6
AA seq 619 aa AA seqDB search
MDDKVNTLPFFYGEITREEAEDYLQQAGMVNGLYLLRQSRNNLGGFALSVSFSDRCYHYS
IERRANETYAIPGGKTHRHPVDVIDYHSQVTDGLVSLLKRPCNRPKNMRPKVGLFEDMKE
KLIREYVQQTWNLQGAALEQAIISQRPKLEKLIATTAHEKMSWFHGAITREDSEPRLQNG
VRPNGKFLVRQRDQSSYALCIIHEGQVMHYRIDQDQIGKLSIPDGKKFDTLWQLVEHYSY
KPDGLLHILTEPCPRHAGENVGPLLPRDHPSLRFSLQSTASKLLHKVKTAPISGTIKTWV
SRHNAAENLNSYETKVLNSSADNKDAMPMDTEVYESPYADPDELRSSTVDRSQLILEDGE
LGSGNFGTVMKGIYKMRKTEKSVAVKILKNDDNNASVREEMLREANVMQQLDNPYIVRMI
GICEAESLMLVMELADLGPLHKFLQKHKQISMKNITELVHQVSMGMRYLEEHKFVHRDLA
ARNVLLVTQHYAKISDFGLSKAVAEEKNYYKAKGHGKWPVKWYAPECINYFKFSSKSDVW
SFGVLMWEAFSYGQKPYKGMKGNEVMQMIESGQRMDAPVNCPSEMYDLMRACWTYKVEGR
PEFTVVEPRLREYYYDISH
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaagtgaacacattacccttcttctatggtgaaatcacaagggaagaagca
gaggactacctgcagcaggccggcatggtcaacggcctgtacctcctacgacagagccga
aacaacctgggagggtttgcgctctctgtctccttctcagaccgctgctaccattacagc
attgaaagacgagccaatgaaacatacgctattcctggggggaagacccacaggcaccct
gtggatgtgattgattaccattcccaggtgacggatggcctggtgtcgttgctgaagagg
ccctgcaacaggcccaagaacatgagaccaaaggttggactgtttgaggacatgaaggag
aagctgatccgagagtatgtgcagcagacatggaacctgcagggtgcagctctggagcag
gctattatcagccaaaggcctaagctggagaagttgattgccaccaccgcacatgaaaag
atgtcttggtttcatggagcaataacgcgagaagactctgagcccaggcttcaaaatggc
gtccgccccaatggaaagttcctggttcgtcagagggaccagagctcatatgctctgtgt
atcatccacgaaggacaggtcatgcattaccgcattgaccaggaccaaataggcaaactg
tccataccagatggaaagaagtttgacaccctgtggcagctagttgaacattattcatac
aagcccgatggtctgctgcacattctaacagaaccctgtccaagacacgctggagagaac
gttggacccctcctgcccagagaccatccttcgttaaggttttcccttcaaagcacagcg
agtaaactcctccacaaagtcaaaaccgctcccatatccggaacaataaagacctgggtg
tcccgacacaatgcagcagaaaacctgaattcatacgagaccaaagtgctcaacagctca
gcagacaacaaagatgcaatgccaatggatacagaggtgtatgagagcccctatgcagac
ccagacgagctgaggagctccacagtggatcgtagtcagcttatcctggaggatggagaa
ctgggctctgggaactttggtaccgttatgaaaggcatctacaaaatgaggaagacggag
aagtcagtggctgtcaaaatcctgaagaacgatgacaacaacgcatcagtgcgtgaggag
atgctgcgagaagccaacgtcatgcagcagctggacaacccctacatcgttagaatgatc
ggaatctgtgaggccgagagcctcatgctggtcatggagctggctgatctgggaccactg
cataagttcctgcagaaacacaagcaaatcagcatgaagaacatcaccgagctggtccac
caggtgtctatggggatgaggtacctggaggaacataagtttgtccacagggacctcgct
gccaggaacgtcctgctggttacgcagcactatgccaagatcagcgacttcggcctgtcc
aaagctgttgctgaggagaagaactactacaaggctaagggtcatgggaagtggccagtc
aaatggtacgctcccgaatgcatcaactacttcaagttttcatccaaaagtgatgtttgg
agctttggggtgctgatgtgggaagccttctcctacggccagaaaccttacaagggaatg
aaaggaaatgaggtgatgcagatgattgaaagtggacagcggatggatgctcctgtcaac
tgtccatcagagatgtacgacctgatgcgggcctgctggacatacaaggtggagggcaga
cctgagttcaccgtggtggagcccagattacgggaatattactacgacatctcccattaa

DBGET integrated database retrieval system