KEGG   Takifugu rubripes (torafugu): 101064289Help
Entry
101064289         CDS       T02386                                 

Gene name
khk
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00051  Fructose and mannose metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    101064289 (khk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101064289 (khk)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     101064289 (khk)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101064289 (khk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-GeneID: 101064289
NCBI-ProteinID: XP_003978558
Position
Un
AA seq 304 aa AA seqDB search
MEEQKKILCVGLVCLDIINVVDKYPEEDTDSRCLSQRWQRGGNASNSCTVLSLLGASSAF
MGSLAAGPVANFILEDFQKFLIDVSLVSEHAQCVLPASVVISNVCTGSRTILHMNRNLPD
VTAENFSDVDLRQFKWVHLEGRNAEEQVKMVQQVEVHNASVPPQQRVTVSVEIEKAREPL
YQLFPHGDVVFVSKDVARHFGFLTAEAALRGFYPRVKQGAVLICAWAEKGADALGPDGLI
VHSDAFPPESLVDTLGAGDTFNAAVIYTLSKGGSLQEALTFGCRVAGWKCGFHGYDSIGE
MFSK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaagagcagaagaagattctgtgcgtcgggctggtttgtctcgacatcatcaacgtg
gttgacaaatatccagaagaagacaccgacagcaggtgtttgtctcagcggtggcaaaga
ggaggaaatgcttcaaactcctgcacggtgctgtccctcctgggggcctctagtgccttc
atgggctcactggctgctggtcccgtagccaattttattttggaggattttcagaagttc
ctcatagacgtgtctctggtttctgagcacgctcagtgtgtccttccagcttctgtggtc
atcagtaacgtctgcacaggaagccgcactatcctccacatgaacaggaaccttcctgac
gtcacagcggagaacttctctgacgttgacctccgtcagtttaagtgggtccacctggag
ggccgaaacgctgaggagcaggtgaagatggtgcagcaggtggaggtgcacaacgcctcc
gtgccgccacagcagagagtcactgtgtcagtggagatcgagaaggccagagagccgctc
taccagctgttcccacacggcgacgtggtgtttgtcagtaaagatgtggcgcgacacttc
ggcttcctgaccgccgaagctgctctgagaggattctaccctcgcgtcaaacagggggcc
gtcctgatatgtgcctgggcagaaaaaggagcagatgctttgggtcctgacggtttgatt
gttcattctgatgcgtttcctcctgaaagtctggttgatactctgggagctggagacacc
ttcaacgctgccgtcatctacacgctgtccaaagggggcagcctgcaggaggcgctgacg
tttggttgcagagtcgctggctggaaatgtggtttccatggttacgatagcatcggagaa
atgttcagtaaatga

DBGET integrated database retrieval system