KEGG   Takifugu rubripes (torafugu): 101064562
Entry
101064562         CDS       T02386                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 5
  KO
K16790  mothers against decapentaplegic homolog 5
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101064562
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 101064562
NCBI-ProteinID: XP_003970131
Ensembl: ENSTRUG00000024615
UniProt: A0A3B5KGR4
Position
14
AA seq 472 aa
MTSMSSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEDLEKALSCPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLEACEYPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHSEFNPQHSLLVQFRNLTHNEPHMPLNATFPESFQQP
HSGGGSSNTGGGSSFPISPNSPYPSSPASSGTYPNSPASSGPSSPFQLPADTPPPAYMPP
DEQLGQESQSMDTTSSLVPPNLARGDVQPVEYEEPSHWCSIVYYELNNRVGEAYQASSTS
VLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDTSI
FVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIR
MSFVKGWGAEYHRQDVTSTPCWIEVHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgacctccatgtcaagccttttttcattcacaagcccagcagttaaacggctgctcggc
tggaaacagggagatgaggaggagaaatgggcagagaaggctgtggatgcactggtgaaa
aaactaaagaagaagaaaggcgccatggaagacctggagaaagctctgagctgccccggg
cagcccagcaaatgtgtcaccattccgcggtcactcgatggccggctgcaggtttctcac
agaaaaggtttacctcacgtgatctactgcagagtgtggcgctggccagacctccagtcc
caccacgagttaaagcccttggaggcgtgtgagtatccatttggctccaaacagaaggag
gtctgcatcaacccatatcactacaagcgagtggagagtcctgtgctccctccggtcctg
gtaccacgtcacagcgagttcaatccacagcacagcttgctggtccaattccgcaacctc
actcacaatgaaccacacatgccactgaacgcaacctttccagagtcctttcagcagccg
cacagtgggggtggcagtagtaacaccgggggaggcagctctttccccatctctcccaat
tctccatatccttcatctccagccagcagtggtacttatcccaattctcctgccagctca
gggccatccagtccattccaacttccagctgacacgccgcctcctgcatacatgcctcct
gatgagcagctcggtcaggagagccagtcaatggacacaactagcagcctggtgccgcct
aacttagcgaggggagatgtccagccggtggagtacgaggagccaagccactggtgttcc
atcgtctactacgaactcaacaatcgtgttggagaagcttatcaggcctcatcaacaagt
gtgctggtggatggtttcactgacccttcaaacaacaagaaccgcttctgccttggactc
ttatccaacgtcaaccgcaactcgacaatcgagaacacccgcaggcacattggcaaaggg
gtgcatctgtactacgtaggaggggaagtgtatgcggagtgccttagtgacaccagtatt
tttgtccagagtcggaactgtaattaccaccacggcttccaccccaccactgtttgtaag
atccccagtggatgtagtctcaagattttcaacaaccaggagtttgctcagcttctggct
cagtctgtcaaccatggctttgaggctgtttatgaacttaccaagatgtgcaccattaga
atgagctttgtgaagggctggggagccgaataccacagacaggacgtcacaagcaccccc
tgctggattgaggtgcatctgcacgggccgcttcagtggttggacaaggtgttgacacaa
atgggttctcctcttaacccgatctcctctgtgtcttag

DBGET integrated database retrieval system