KEGG   Takifugu rubripes (torafugu): 101065083Help
Entry
101065083         CDS       T02386                                 

Gene name
mtmr2
Definition
(RefSeq) myotubularin-related protein 2 isoform X1
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00562  Inositol phosphate metabolism
tru01100  Metabolic pathways
tru04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101065083 (mtmr2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    101065083 (mtmr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tru01009]
    101065083 (mtmr2)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     101065083 (mtmr2)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     101065083 (mtmr2)
Protein phosphatases and associated proteins [BR:tru01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    101065083 (mtmr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase 3-PAP DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 101065083
NCBI-ProteinID: XP_003971171
Ensembl: ENSTRUG00000015525
UniProt: H2URX6
Position
15
AA seq 647 aa AA seqDB search
MEKSGSVDSLGSKRFSSRQPSVDSLSSTSTSRSDRSGPAKPPSAMSSDSASTSTDLSPEL
RVKPKAVNKKVLRDSDKEEPQLLPNETVQNLALDITYFCPFIGALRGTVTVTNYRLFFKC
MDRDPTFVLDLPLGVLSRVEKVGGASSRGDVSYLLVCKDMRHLQFAHKQIEDTLRKSIFE
VLMKFAFPVSNGLQIFAFDYGQVFPENGWKVYDAVSEYKRQGIPNESWRITKVNDHYDLC
DTYPSTLVVPVNIPDEELKRVAAFRAKGRIPVLSWIHPESQATVTRSSQPMVGVNGKRSK
EDEKFLQAIMDANAQSHKLFIFDARPSVNAAANKMKGGGYESEDAYQNAELFFLDIHNIH
VMRESLRKLKDVVYPNIEDSHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHC
SDGWDRTSQLTSLSMLMLDGYYRTIRGFEVLLEKEWLSFGHRFQLRIGHGDKNHTDADRS
PVFIQFVDCVWQLTRQFPSAFEFNEYFLVTILDHLYSCLFGTFLCNCEQQRMKEEIPKRT
VSLWSYINSQLEEFTNPLYVNYSNHVLFPAVSLRHLELWVGYYIRWNPRMRPQEPVHQRH
KDLLAKRAELQKRVDELQREVTNRSASSSSERAGSPTRSITPVQTFV
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagcgggagtgtcgatagtttgggctccaaacggttctcttcccgacagcca
agtgttgattcattgtccagcacttccacttctcgttccgaccgatctggcccagctaag
ccaccctcagccatgtcctcggactctgcgtccacctctacagatctctccccggagctc
agggtgaagcccaaggctgtcaataagaaggtgttaagagattctgacaaagaggaaccg
cagttacttccaaatgaaactgtgcaaaacctagccctggatatcacctacttctgtcct
tttattggagcacttaggggaacggtcacagtcaccaactatagacttttcttcaaatgt
atggacagggatcccacctttgtattagacctgccccttggagtattgagtcgtgtggag
aaagtaggtggtgcttcaagtcgtggcgacgtgtcgtatttactggtttgcaaggatatg
cgtcacctccaatttgcacacaaacaaatagaggacactctcaggaagtccatttttgaa
gtgctgatgaaatttgcctttcctgtttccaatggcctgcaaatctttgcctttgattac
ggacaagtctttcctgaaaatggatggaaggtgtacgatgctgtctcggagtacaaaaga
cagggtatacccaatgaaagctggaggataacgaaggtaaacgaccactacgatctttgt
gacacctacccgtcaactttagtggtacctgtcaacataccagacgaagaactgaagagg
gtggctgccttccgtgccaaaggaaggatacccgtgctgtcgtggatccacccagagagc
caggcgacggtgacgcgctccagtcagcccatggttggggtcaatgggaaacggagcaaa
gaggatgagaagttcctccaggcaatcatggatgctaatgctcagtcccataagctcttc
attttcgatgcaaggcccagtgtcaatgctgccgccaataagatgaaagggggtggttac
gaaagtgaagatgcgtatcagaacgctgagctgtttttcttggacattcacaacatccac
gtgatgagagagtcactccgcaagttaaaggacgtggtctatcccaacattgaggattcc
cactggctctccaatctggagtccactcactggcttgagcacatcaagctgattctcgca
ggagcgctgcggatcgcagacaaggtggagtctgggaagacctcggtggtggtgcactgc
agtgatggctgggaccggacgagccagctcacctccttgtccatgctcatgctggacggc
tattaccgcaccattcgtggttttgaggttctgctcgagaaagagtggctgagctttggt
caccgcttccagctgcgtatcggacatggtgataagaaccacacagatgctgaccgctca
cccgtctttatccagtttgttgactgcgtttggcagttgactagacagtttccctctgcg
tttgagtttaacgaatacttcctggtcaccatcctggatcacctgtacagctgcctgttt
gggacattcctgtgcaattgtgagcaacagagaatgaaggaagagatcccgaagaggacc
gtgtcattgtggtcttacattaacagtcagctggaggagttcaccaatcctttgtatgtg
aactattccaaccatgtgctgttccctgctgtcagcttacgtcacctggagctctgggtc
ggctactacatccgctggaaccctcgtatgagaccacaggagcctgttcaccagcgtcac
aaggatttgctggcaaaacgtgccgagctccagaaaagagtggatgagttacagcgagaa
gtcaccaaccgctcagcctcatcgtcttcggaacgggccggctcccccacacgctccatc
actccagtgcagaccttcgtttga

DBGET integrated database retrieval system