KEGG   Takifugu rubripes (torafugu): 101065558Help
Entry
101065558         CDS       T02386                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13-like
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04270  Vascular smooth muscle contraction
tru04371  Apelin signaling pathway
tru04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101065558
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101065558
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101065558
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101065558
   04031 GTP-binding proteins [BR:tru04031]
    101065558
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101065558
  Exosomal proteins of colorectal cancer cells
   101065558
GTP-binding proteins [BR:tru04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    101065558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA MMR_HSR1 Roc FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 101065558
NCBI-ProteinID: XP_003978181
UniProt: A0A3B5KQ93
Position
Un
AA seq 377 aa AA seqDB search
MADFLPTRSVLKVCLPVCLLNSSEVEQLRKSKEIDRCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQHAREEFRATIYSNVIKGMRVLVDARGKLHIPWGDKDNQQHGD
SLMAFDTRSAKMASGQLETSVFLQYLPAIQALWADSGIQNAYDRRREFQLGESVKYFLDD
LDKLGDPTYVPSQQDILLARKPTKGIHEYDFEIKNVPFKMVDVGGQRSERRRWFECFDSV
TSILFLVSSSEYDQVLMEDRQTNRLRESLDIFETIVNNRVFVNVSIILFLNKTDLLEEKV
QSVPLKDYFPEYTGPEHSLADIQAFMVECFRARRRDATQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttcctgccgaccagatccgtgttaaaagtttgtctgcccgtctgcctgctg
aacagcagcgaggtcgagcagctccgaaagtccaaggagatcgaccgatgtctctcccgg
gagaaaacctacgtgaagcggctggtgaagatccttctgctcggcgctggcgagagcggc
aagtcgactttcctcaaacaaatgcggatcatccacggccaggacttcgaccagcacgcc
cgggaggagttcagggccacgatctacagcaacgttatcaaaggtatgcgcgtgctggtg
gacgcccgaggaaagctgcacatcccctggggagacaaagacaaccagcagcacggggac
agcctgatggcgttcgacacccgctcggcgaagatggcgagcgggcagctggagacgtcc
gtcttcctgcagtacctgcccgccatccaggccctgtgggccgactcgggcatccagaac
gcctacgaccgtcgcagggagtttcagctgggggagtcggtgaagtatttcttggatgat
ctggataaactcggcgacccgacttatgtgcccagccagcaggacatcctgctggcccgt
aaacccaccaagggcatccacgagtatgactttgagatcaagaacgttcccttcaagatg
gtggacgtgggcgggcagcgctcggagcggcggcgttggtttgaatgctttgactcggtc
acctccatcctcttcctggtctcgtcctctgaatacgaccaggtgctgatggaggaccgg
cagaccaaccggctccgagagtcgctcgacatcttcgagaccatcgtcaataaccgcgtc
tttgtcaacgtatccatcatcctcttcctcaacaagacggacctgctggaggagaaggtg
cagagcgttccgctcaaggactattttcctgagtacaccgggccggagcacagcctggcc
gacatccaggccttcatggtagaatgtttccgggccaggaggcgcgatgccacgcagaag
cctctctaccaccacttcaccaccgccatcaacacggagaacatcaggctggtgttccgg
gacgtcaaggacaccatcctgcacgacaacctcaagcagctcatgctccaatga

DBGET integrated database retrieval system