KEGG   Takifugu rubripes (torafugu): 101066321
Entry
101066321         CDS       T02386                                 

Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101066321
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tru03310]
    101066321
Transcription factors [BR:tru03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    101066321
Nuclear receptors [BR:tru03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   101066321
SSDB
Motif
Pfam: Hormone_recep DUF2722 DUF3402 TFIIA RITA Spt20 Mlh1_C TERB2 Roughex
Other DBs
NCBI-GeneID: 101066321
NCBI-ProteinID: XP_003961802
Position
1
AA seq 308 aa
MATLEGCRCRGSGGRNTNNSILYSILKSDTLATTEEQQPKQQQQQQQQQQQQQQQQQQQS
LQHLLFKSPPASTAAPASLQELRQQACSCGSTRRRGVLRSPQVTCKAASAVLVKTLRFVK
NVPCFRELPEDDQLALIRSGWAPLLVLGLAQDRVDFETTETVEPSMLQRILTGSPEGRNQ
ALGCHSRTAAGVSVLDIEAIKAFLKKCWSVDISTKEYAYLKGAVLFNPDVEGLRCLHYIQ
SLRREAHQALNEHVRLIHREDTTRFAKLLIALSMLRAIRPPVVAQLFLKPVIGTVNIEEV
LMEMFYGK
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccacgctggagggctgccgctgccggggtagcggcggccgcaacaccaacaacagc
atcctctacagcattttaaagagtgacactcttgcgaccaccgaggagcagcagcccaaa
caacaacaacaacaacaacaacaacaacaacaacaacaacagcagcagcagcagcagagc
cttcagcacctgctcttcaagagcccacctgcctccaccgccgccccagcctccctgcag
gagctccggcaacaggcttgctcgtgcggctcgacgcgccgccggggcgtgctccgctcc
ccgcaggtgacctgcaaagccgcgtcggcggttctggtcaagacgctgcggttcgtgaaa
aacgtgccgtgtttccgcgagctgccggaggacgaccagctcgcgctgatccgcagcggg
tgggcgcctctgctcgtgctgggactcgcgcaggaccgcgtggattttgagaccacggag
acggtggagcccagcatgctgcagcgcatcctcaccggctcccccgagggacggaaccag
gcgctcggctgccacagcaggacggcagcgggggtgtccgtcctggatatcgaagccatc
aaagcttttctgaagaagtgctggagcgtggacatcagcaccaaggagtacgcgtacctg
aagggagccgtgctgttcaacccagatgtggagggtctgcgctgcctccactacatccag
tctctgcgccgagaagcgcaccaggctctgaacgagcacgtccggctgatccaccgtgag
gacacgacccgcttcgccaaactgctcatcgccctgtccatgctgagggccatcaggcca
ccggtggtggcacagctcttcttaaagcccgtaattgggaccgtcaacatcgaggaggtc
ctcatggagatgttctacgggaagtag

DBGET integrated database retrieval system