KEGG   Takifugu rubripes (torafugu): 101066787Help
Entry
101066787         CDS       T02386                                 

Definition
(RefSeq) transforming growth factor beta-2 proprotein
  KO
K13376  transforming growth factor beta-2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04060  Cytokine-cytokine receptor interaction
tru04068  FoxO signaling pathway
tru04110  Cell cycle
tru04218  Cellular senescence
tru04350  TGF-beta signaling pathway
tru04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101066787
   04350 TGF-beta signaling pathway
    101066787
   04068 FoxO signaling pathway
    101066787
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101066787
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101066787
   04218 Cellular senescence
    101066787
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101066787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tru04052]
    101066787
   00536 Glycosaminoglycan binding proteins [BR:tru00536]
    101066787
Cytokines and growth factors [BR:tru04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101066787
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101066787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 101066787
NCBI-ProteinID: XP_003965777
Ensembl: ENSTRUG00000022457
UniProt: A0A3B5KUK1
Position
Unknown
AA seq 413 aa AA seqDB search
MNLCLVSLLLAVDLATVAFSLSTCSTLDMEQFKKKRIKAIQGQILSKLKLSSPPTEFPEP
EDVSSDIVAIYKSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPIYPSENIISH
TQSNPYFRRLMFDVSSMEKNASNLVKAELRIFRLQNPAARVSEQRIELYQILGHKDFTSP
TQRYIDSRVVRTQTEGEWLTFDVTEAVSEWLNHRGRNSGFKLSLHCPCCTLIPSNNYIIP
NKSEELEARFAGIDDSFIHGSDLKMFKKQRHKTRGPYLLLMLLPSYRLESQFQHKNYRSK
RALDAAYCSRNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYEANFCAGACPYLWSADTQHS
KVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKCS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtgtctcgtcagtctcctcctggctgtagatttggccactgtggcttttagt
ttgtccacatgcagcacgctggacatggagcagttcaagaagaagcgcatcaaggccatc
caagggcagatcctgagtaagttaaagctctccagcccaccgactgagttccccgagcca
gaggacgtttcttcggacatcgtggccatttacaaaagcacccgcgacctgttgcaggag
aaggcgaacgaacgcgcggcgacgtgcgagcgccaacgaagcgaggaggaatattacgcc
aaagaggtgcacaagatcgacatgcagcccatctatccatcagagaacatcatctcccac
acacagtccaatccttacttccggagactcatgtttgatgtgtcctctatggagaagaat
gcctccaacctggtcaaggcagagctgagaattttccgtctccagaaccctgcagccaga
gtgtctgagcaacgcatcgagctctatcagattttaggacacaaagattttacctcccca
acgcagcggtacatcgacagcagggtggtccggacacaaacggagggcgagtggctgacc
tttgatgtgaccgaggccgtgagtgaatggctgaatcacagaggcagaaacagtggattc
aagctcagcctgcactgtccatgttgtacacttattccatcaaacaactacattattcct
aacaagagtgaggaactggaggcacggtttgcaggcatcgacgacagcttcatccatggc
agcgacctaaagatgtttaaaaagcaacgacacaagactcgaggtccatacctgctcctg
atgctgttgccttcctacagattagagtctcagttccagcacaagaactaccgatccaag
cgagcgctggatgctgcctactgctcaagaaatgttcaggacaactgctgcttgcggtca
ctctacatcgactttaagaaggacctgggctggaggtggattcatgagcccaagggctat
gaggctaacttctgtgctggggcttgtccctatctgtggagcgccgacacccagcattcc
aaggtgttgggcttgtacaacactatcaaccccgaagcgtcagcatcaccgtgctgtgtg
tcccaggacctggaacccctcaccattctctactacattggcaagacaccgaaaatagag
cagctttccaacatgaaggtcaagtcttgcaagtgcagctag

DBGET integrated database retrieval system