KEGG   Takifugu rubripes (torafugu): 101067171Help
Entry
101067171         CDS       T02386                                 

Gene name
lypla2
Definition
(RefSeq) lysophospholipase II
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101067171 (lypla2)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101067171 (lypla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 FSH1 Abhydrolase_3 Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DLH DUF2974 Cutinase Esterase Lipase_3 AXE1
Motif
Other DBs
NCBI-GeneID: 101067171
NCBI-ProteinID: XP_003968863
Position
12
AA seq 230 aa AA seqDB search
MCGNNMSVPLLTNAVTVSGTEKETAVVIFLHGLGDSGHGWTETLTEIQPPYVKFICPHAP
AIPVTLNKNAIMPAWFDLMGLSHDSPEDEAGIKKAAENIKAIIEHEAKNGIPPHRIILGG
FSQGGALSLYTALTCQHQLAGVVALSCWLPLHKSFPSAFSGHKYLPILQCHGEMDFMIPL
RFGDMTSKTIQSIVDPQMVSFKSYAGLPHSSSPQEMADVKEFIEKYLPRI
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaaacaacatgtctgtgccgctgctcaccaatgctgtgacggtgtctgggaca
gagaaggagaccgcagtggttatcttcctccatgggttgggagatagtggtcacggttgg
acagaaactttgacggagattcagcctccgtatgtcaagttcatctgcccccacgcacca
gcaattcctgtcacgctcaacaagaatgcgataatgcctgcgtggtttgacctcatgggt
ctcagccatgactccccagaggatgaagctggtatcaagaaggcagcagaaaacataaag
gccataattgaacatgaggccaaaaatgggatcccccctcaccgtataatccttggtggt
ttttctcagggtggggccttgtctttgtatactgccttgacctgtcagcatcagttagct
ggtgttgtggccctcagctgctggctaccacttcacaagagtttcccatcggcattcagt
ggccacaagtacctccccatcctgcagtgtcacggtgaaatggacttcatgatcccattg
cgtttcggagacatgacgtcaaaaacaatccaatccatagttgaccctcagatggtctcc
ttcaaatcttacgcaggactccctcacagctcctctcctcaggagatggcagatgtaaag
gaattcattgagaagtatttacccagaatctga

DBGET integrated database retrieval system