KEGG   Takifugu rubripes (torafugu): 101067191Help
Entry
101067191         CDS       T02386                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00562  Inositol phosphate metabolism
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04070  Phosphatidylinositol signaling system
tru04140  Autophagy - animal
tru04150  mTOR signaling pathway
tru04210  Apoptosis
tru04218  Cellular senescence
tru04370  VEGF signaling pathway
tru04510  Focal adhesion
tru04620  Toll-like receptor signaling pathway
tru04625  C-type lectin receptor signaling pathway
tru04810  Regulation of actin cytoskeleton
tru04910  Insulin signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04933  AGE-RAGE signaling pathway in diabetic complications
Module
tru_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101067191
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101067191
   04370 VEGF signaling pathway
    101067191
   04068 FoxO signaling pathway
    101067191
   04070 Phosphatidylinositol signaling system
    101067191
   04150 mTOR signaling pathway
    101067191
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101067191
  Cell growth and death
   04210 Apoptosis
    101067191
   04218 Cellular senescence
    101067191
  Cellular community - eukaryotes
   04510 Focal adhesion
    101067191
  Cell motility
   04810 Regulation of actin cytoskeleton
    101067191
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101067191
   04625 C-type lectin receptor signaling pathway
    101067191
  Endocrine system
   04910 Insulin signaling pathway
    101067191
   04914 Progesterone-mediated oocyte maturation
    101067191
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101067191
  Infectious diseases
   05163 Human cytomegalovirus infection
    101067191
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101067191
Membrane trafficking [BR:tru04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101067191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF4135 C2 Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 101067191
NCBI-ProteinID: XP_003975806
Position
22
AA seq 1068 aa AA seqDB search
MPPRPSSGELWGMHLMPPSILVECLLPNGMILTLECLREATLITVKHELFKEARKYPLYH
LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDPEVQDFRRNILNVCKEAVDLRDCNGPHSRALYVYPPNVESSPELPRH
IYNKLDKGQIIVVIWVIVSPTNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSQEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPMD
IFTIPSYARRISTATPYMNGETATKALWTINGTLRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLSYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINMFDYTHTLVAGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFEHF
GCPVKYPDMTIIEEHANWNISRELGFNYCHTGLSSRLARDNPVTDADNDQLRQVCTRDPL
SEITEQEKDFLWRHRQDCLNMPEILPKILLAVKWNSRDEIAQMYCLLKDWPAIRPEQAME
LLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKRALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccagaccatcctcgggagagctatgggggatgcacttgatgccccccagcatc
ctggtggagtgcctgctgccaaatggcatgattctcacgttggagtgcctccgggaggcc
acgttgatcacagtcaagcacgagctcttcaaagaggccaggaaataccctctttaccat
ctgctgcaggaggagagctcctacatcttcgtcagcgtcacccaagaggcagaacgggag
gagttttacgacgagacgaggaggttgtgcgacctgcggctcttccaggcgttcctcaaa
gtcattgagccggtgggcaacagggaagagaagattctcaacagagagatcggttttgcc
atcgggatgccgatatgcgaatttgatctggtgaaggatccagaggtgcaggacttcagg
cgcaacattttaaatgtttgcaaagaggcggtggatctcagagattgcaacgggccccac
agtagagctctgtacgtctaccctcccaacgtggagtcgtctccggagcttcccaggcac
atctacaacaagctggacaaaggtcaaatcattgtggtcatatgggtcattgtgtcgccc
accaacgacaagcagaaatacaccctgaagatcaaccacgattacgtcccggagcaggtg
atcgccgaagccatccgcaagaagacgcgcagcatgttgctgtcccaggaacagctgaag
atgtgcgtgcaggagtaccagggaaagtacatcctcaaagtgtgcggatgtgatgagtac
ttactggagaagtaccctctgagtcagtacaagtatgtccgcagctgcatcatgctgggg
cgcatgcccaacctgatgctgatggccaaagacagcctgtattcccagctgcccatggac
atcttcaccataccgtcctacgccaggaggatctccacagccacgccctacatgaacggc
gagacggccaccaaagccttgtggacgatcaacggaacactgaggattaagattctttgt
gccacttatgtcaatgtcaacatcagagacatcgacaagatctacgtgaggactgggatt
taccacggtggagagcagctgtgcgacaacgtcaacacccaaagagtgccctgctccaac
cccaggtggaacgagtggctcagctacgacatgtacattccagacatccctcgcgccgcc
cggctctgcctgtccatctgctctgtgaaaggcaggaagggagctaaagaggaacactgt
cctctggcctggggcaacatcaacatgtttgactacacccacacgctggtggcaggaaaa
atggctctcaacctgtggcctgtccctcacggcctggaagacctgctcaaccccatcggc
gtcacgggctctaaccccaacaaggaaactccatgtctggagctggagtttgaacacttc
ggctgcccagttaagtaccctgacatgaccatcatcgaagagcacgccaactggaatata
tccagagagctgggcttcaactactgccacaccggtttgagcagcagattagcgcgcgac
aacccggtgaccgacgctgacaatgaccagctccgccaggtgtgcaccagagacccgctg
tctgagatcactgagcaggagaaggacttcctgtggaggcacagacaagactgcctcaat
atgccagagattcttcccaagatcctcctcgctgtgaaatggaactccagagatgagatc
gcgcagatgtactgcctcctgaaggactggcccgccatcaggccagaacaggccatggag
ctgctggactgtaacttccccgaccccatgatccgagagtttgctgtaaagtgccttgag
aaatatctaacggatgacaaactctcccagtacctcattcagctggttcaggttcttaaa
tacgaacagtacctcgataacccactcgcacgcttccttctgaaaagagcgttaaccaat
cagaggataggacatttcttcttttggcatttgaagtcagagatgcacaacaagacggtg
agccagcgcttcggcctgctgctggagtcgtactgccgggcctgtggcatgtatctgaag
cacctgagcaggcaggtggaggccatggagaagctcatcaatctcactgatctcctcaaa
caggagaagaaagatgaggcgcagaaggttcaaatgaagttcctggtggagcaaatgcga
aggcccgactacatggatgccctgcagagtttcacatccccacttaatccagcacatcag
ctgggcaacctccgcctggaagaatgcaggatgatgtcatccgccaagcgacctctgtgg
ctgaactgggagaatccagatatgatgtcagagctgcttttccagaacaacgaaatcatt
ttcaaaaatggtgacgatctgagacaagacatgctgacgctgcagataattaggataatg
gagaacatctggcagaaccagggccttgatctcaggatgctgccgtacggctgcctgtcc
atcggcgactgcgtgggcttgatcgaggtggtgaggaactcccacaccatcatgcagatc
cagtgcaaaggaggcctgaagggggcgctgcagttcaacagccacacgttacaccagtgg
ctcaaggataaaaacaaaggagagatgtacgaccaggccatagacctgttcacccgctcc
tgcgcaggctactgcgtcgctacttttattctgggcattggggacagacacaacagcaac
atcatggtcaaggatgacggacagctgttccatatcgactttggccattttctggaccac
aaaaagaagaaatttgggtacaagagggagcgggtgcccttcgtgctgacgcaggacttc
ctgattgttattagtaaaggagctcaggagtgcaccaagacgagggagtttgaaaggttc
caggagatgtgttataaggcgtacctggcaatcagacagcacgccaacctcttcatcaac
ctcttctccatgatgctgggctccgggatgcccgagctgcagtccttcgatgacatcgcc
tacatcagaaagactctggccctggacaaatcggagcaggaggccctggactacttcatg
aagcagatgaacgacgctcaccacggcggctggactactaaaatggactggatcttccac
acgatccgccagcacgccatgaactaa

DBGET integrated database retrieval system