KEGG   Takifugu rubripes (torafugu): 101067675Help
Entry
101067675         CDS       T02386                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00562  Inositol phosphate metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101067675 (minpp1)
   00562 Inositol phosphate metabolism
    101067675 (minpp1)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101067675 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101067675 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF3764
Motif
Other DBs
NCBI-GeneID: 101067675
NCBI-ProteinID: XP_003964038
Position
4
AA seq 464 aa AA seqDB search
MTAPVWKVIVRFAAVFGLCAGFRCDVVAEENPNIPAIANYFTTKGRYEEVNPHLIDDILA
VNSSILQPPSAQCRIIHLTAIVRHGTRYPTGKNIKKMHDFYELVKSSAVGRESWLQELQN
QWTMWYTEDMDGRLVQKGVDDLKNLAVRLSKLFPSMISEEKLRAGMIKFITSSKHRCVNS
TLSFKAGLTELWAISDQEIEHTVNDALMRFFDQCTRFVQEVDGNPSALSEVESFRLGPEM
RRVQEKIAERLRVPYSDITCDSAEAAFYLCAYEFAIKTVNSPWCRLFDQVDAQIMEYAND
LKQFWKRGYGHDINSKSSCILFHDLFSRLEKAVSDHKSGQKVTEAVTVQVGHAETLLPLL
TLLGFFKDNNRMTSVNYAAQTRRSFRTSLIVPYAANLVLVLYDCGNDDLRLQPLLNEKPV
DFPGLTTQKASMPRFQDVKELYRELLQGCDFESECRLFRAPAEG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccccgtttggaaagttatcgttcgattcgccgccgtattcggtttgtgcgca
ggttttcgatgcgacgtggtcgcggaggaaaacccgaacattccggcgatcgccaactac
ttcaccaccaaagggagatacgaggaggtcaacccgcacctcatcgacgacatccttgcg
gtaaacagctctattttgcagcctccgtccgctcaatgtcgcataatccacttgactgcc
atcgttagacacggcaccaggtacccgacgggcaaaaacatcaagaagatgcacgatttt
tacgagctggtgaagagcagtgccgtgggtcgggagagctggctgcaggagctccagaac
cagtggacgatgtggtacaccgaggacatggacggtcggctggtccagaaaggtgtggac
gacctcaagaatttggccgtcagactgtcgaagctgttcccctcgatgatctcagaggag
aagctccgagccggaatgatcaagttcatcaccagctcgaagcacagatgtgtcaacagc
accctgtccttcaaggcagggctgaccgagctgtgggcaatctcagatcaggagatcgag
cacacagtcaacgacgccctgatgaggttctttgaccagtgcaccaggtttgtgcaggag
gtggacgggaacccctcggctctgtccgaggtggaaagtttcaggctggggccagagatg
aggagggtccaggagaagatcgcagaacgcctcagagtcccttacagcgatatcacgtgc
gattcggccgaagctgcgttttacttgtgcgcttatgaatttgccatcaagacggtgaac
tctccctggtgtcggctctttgaccaggtggacgcgcagattatggagtacgcaaacgac
ttgaagcaattctggaaaaggggctatggacacgatattaacagcaagtccagctgcatc
ctctttcacgacctgtttagtcggctggaaaaagcagtttcagaccacaagtcaggccag
aaggtgactgaagccgtgacggtccaggtcggccatgctgaaaccctcctaccgctgctc
acactcctgggcttcttcaaggacaacaacagaatgacttctgtcaattacgccgcccag
acacgacgctccttccgcaccagcctcatcgtgccgtacgccgccaacttagtcctggtg
ctgtacgactgcggcaacgatgacctgaggctgcagccgctgctcaacgagaaaccggtg
gatttccctggtctgaccacccagaaggcctccatgcctcgcttccaggacgtcaaagag
ctctacagggaactgctccaaggctgtgactttgagagcgagtgtcggctcttcagagct
ccagctgagggttag

DBGET integrated database retrieval system