KEGG   Takifugu rubripes (torafugu): 101067839Help
Entry
101067839         CDS       T02386                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04012  ErbB signaling pathway
tru04068  FoxO signaling pathway
tru04137  Mitophagy - animal
tru04140  Autophagy - animal
tru04141  Protein processing in endoplasmic reticulum
tru04210  Apoptosis
tru04217  Necroptosis
tru04310  Wnt signaling pathway
tru04510  Focal adhesion
tru04530  Tight junction
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04625  C-type lectin receptor signaling pathway
tru04910  Insulin signaling pathway
tru04912  GnRH signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04920  Adipocytokine signaling pathway
tru04933  AGE-RAGE signaling pathway in diabetic complications
tru05132  Salmonella infection
tru05168  Herpes simplex infection
Module
tru_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101067839 (mapk10)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101067839 (mapk10)
   04012 ErbB signaling pathway
    101067839 (mapk10)
   04310 Wnt signaling pathway
    101067839 (mapk10)
   04068 FoxO signaling pathway
    101067839 (mapk10)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101067839 (mapk10)
   04137 Mitophagy - animal
    101067839 (mapk10)
  Cell growth and death
   04210 Apoptosis
    101067839 (mapk10)
   04217 Necroptosis
    101067839 (mapk10)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101067839 (mapk10)
   04530 Tight junction
    101067839 (mapk10)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101067839 (mapk10)
   04621 NOD-like receptor signaling pathway
    101067839 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    101067839 (mapk10)
   04625 C-type lectin receptor signaling pathway
    101067839 (mapk10)
  Endocrine system
   04910 Insulin signaling pathway
    101067839 (mapk10)
   04920 Adipocytokine signaling pathway
    101067839 (mapk10)
   04912 GnRH signaling pathway
    101067839 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    101067839 (mapk10)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101067839 (mapk10)
  Infectious diseases
   05132 Salmonella infection
    101067839 (mapk10)
   05168 Herpes simplex infection
    101067839 (mapk10)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101067839 (mapk10)
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101067839 (mapk10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2
Motif
Other DBs
NCBI-GeneID: 101067839
NCBI-ProteinID: XP_003965226
Position
6
AA seq 467 aa AA seqDB search
MVFMSRHFLYNCSQPILDVKIAFCQGFGQQVDVSYIAKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHP
YINVWYDPAEVEAPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKGQPSPS
GAAVNSSESPPPSSSINDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtctttatgagcagacatttcttatataactgcagccaaccgatcctggatgtgaag
attgccttttgtcagggttttggacaacaagtggatgtatcatatattgccaaacattac
aacatgagcaaaagcaaagtggacaaccagttttacagcgtggaggtgggggactccacc
ttcacggtcttaaaacgctaccagaatttgaagcccatcggctctggagctcagggaatt
gtctgcgcgggctacgatgccgtcctagacagaaatgtggccatcaagaagctgagcaga
cccttccagaaccagacccatgccaagagggcataccgggagctcgtgctcatgaaatgc
gtcaatcacaaaaacatcatcagtttattaaatgtcttcacaccacagaaatcattagag
gaattccaggatgtctatctagtcatggagctgatggacgccaacctctgccaggtgatt
cagatggagctcgaccatgagagaatgtcctacctgctctaccaaatgttgtgtgggatc
aaacatctgcactcagccggcattatccacagggacctcaaaccgagcaacatagtggta
aagtcggactgcaccctgaaaatcctggactttggcctggctcggactgcaggcaccagc
ttcatgatgaccccctacgtggtgacgagatactacagagccccagaggtgatcctcggc
atgggctacaaggagaacgtggatatttggtcggtggggtgcattatgggagaaatggtg
cgccacaaaatcctcttccccgggcgggactacatcgaccagtggaacaaggtgatcgag
cagctgggaacaccctctccagagttcatgaagaagcttcagcccacagtgaggaactac
gtcgagaaccggccgaagtacgccggcctcacctttcccaaactgttccccgactgcctt
ttccctgctgactcggagcacaacaaactcaaagccagccaggccagagacctgctgtcc
aagatgctgattatcgaccctgctaaaagaatatcggtggatgaggccttgcagcacccc
tacatcaatgtgtggtacgatccagctgaagtggaggcgccccctccacagatctatgac
aaacagctggatgaaagagaacactccattgatgaatggaaagaactaatttacaaagag
gtgatgaactttgaggagagaacgaagaatggcgttgtgaagggacagccttcaccttca
ggtgcagccgtgaacagcagcgaaagcccccctccctcctcctccatcaacgacatctcc
tccatgtccaccgaccagaccctggcatccgacactgacagcagcctggagacctctgca
ggaccactggggtgttgcaggtga

DBGET integrated database retrieval system