KEGG   Takifugu rubripes (torafugu): 101067994Help
Entry
101067994         CDS       T02386                                 

Definition
(RefSeq) erlin-1-like
  KO
K23341  erlin
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tru04121]
    101067994
Ubiquitin system [BR:tru04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101067994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 DUF4346
Motif
Other DBs
NCBI-GeneID: 101067994
NCBI-ProteinID: XP_003964203
Ensembl: ENSTRUG00000014128
UniProt: H2UGS1
Position
4
AA seq 338 aa AA seqDB search
MTMPQIWTVFAAISGVIAIMLHSSIHKIEEGHLAVYYRGGALLTSPNGPGYHIMLPFITT
YRSVQTTLQTDEIKNVPCGTSGGVMIYFDRIEVVNMLVPSAVVDIVRNYTADYDKTLIFN
KIHHELNQFCSVHTLQEVYIELFDIIDENLKISLQKELNVMAPGLTIQAVRVTKPKIPES
IRRNFELMEAEKTRLLITTQTQRIVEKEAETERKRAIIEAQKVAQVAEIQFQQKVMEKET
EKRISEIEDAAFLAREKARADAEYYTAARLSEANTLKLTPEYLELMKFQAIAANSKIYFG
QDIPNMFVEGGSDHSKATQLRNLPNLHSDSLKVKTQGQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgactatgccacaaatatggaccgtatttgctgcgatatcgggggtgattgccatcatg
ttgcactcctccatccacaagatagaagaaggacaccttgctgtgtactacaggggcggg
gcgttgttgacgagtcccaatggtcctggatatcacatcatgctgccttttattaccacc
tacagatcagtgcagacgacgctccaaacggatgagatcaagaatgtgccttgtggaacc
agtggcggtgtgatgatttattttgacaggatagaggttgttaacatgctagtcccctca
gcagtggtggatatagtcaggaactacactgctgattatgataagacccttattttcaac
aagattcaccatgaactgaatcagttctgcagcgtgcacacgctgcaggaggtctacatc
gagctgtttgacatcatagatgagaacctgaaaatttcactgcagaaggagctgaatgta
atggcccctggactcaccatacaggcggttcgtgtcacaaagccaaagatccccgagtct
atcaggaggaactttgaactcatggaagcagagaagactcgtctgctgatcacgactcag
acccagagaatcgtggaaaaggaagcagaaactgaaaggaagcgtgccatcatcgaggct
caaaaggtggcccaggtggccgagatccagttccagcagaaggtgatggagaaagagacc
gaaaaaaggatctctgaaatagaagatgctgcctttttagcgagggagaaagcgagggct
gatgcagaatattacacggctgcccgattatctgaagcaaacacgctgaagttaaccccg
gagtacctggagctgatgaaattccaggccattgcagctaacagcaagatctactttggc
caagacatcccaaacatgtttgtagagggcggcagtgaccactccaaggctacgcagtta
cgtaatttgccaaatcttcattcagactcattgaaagtcaagacccagggccagtaa

DBGET integrated database retrieval system