KEGG   Takifugu rubripes (torafugu): 101068642Help
Entry
101068642         CDS       T02386                                 

Gene name
LPL2
Definition
(RefSeq) lipoprotein lipase-like
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00561  Glycerolipid metabolism
tru01100  Metabolic pathways
tru03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101068642 (LPL2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101068642 (LPL2)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101068642 (LPL2)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101068642 (LPL2)
  Exosomal proteins of breast milk
   101068642 (LPL2)
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   101068642 (LPL2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tru00537]
 Enzymes
  101068642 (LPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_1 Abhydrolase_6 VirJ DUF900
Motif
Other DBs
NCBI-GeneID: 101068642
NCBI-ProteinID: NP_001292532
UniProt: L8AZK3
Position
20
AA seq 509 aa AA seqDB search
MKAWKSGVVFILVLNAAVCHVTTLEGELADSISGNFLDPIKDLLNDRDDSNQTVARFSLR
KPSHPDADQCYIVPGRADTLAACTFNRTSKTFMVIHGWTLSGMFESWVSKLVSALYEREH
GANVIVVDWLTLAQNHYVLAAQKTKAVGQEIARFIDWIEESTNAPVENIHLIGYSLGAHV
AGFAGSHVTNKVGRITGLDPAGPDFEGMHAHRRLSPDDAHFVDVLHTFTRGSLGLSIGIQ
QPVGHVDIYPNGGSFQPGCNLRGTLEKIANFGIFAITDAVKCEHERSVHLFIDSLLNEQD
AAQAYRCSSSQTFNRGMCLSCRKSRCNTVGYDISKVRKARNVQMYTKTRATMPFRVYHYQ
LKIHFSSKVNRSEMEPSLTVSLYGTKGEAENLELKLKEKIAVNKTHSFLLVTEKDVGDLL
MLTFKWEETNSWSSSRLLKMVSSWWGGDSGGADVQVHKIRVRAGETQQKMVFCVKNPDVQ
NLMREVTFVRCKDAWRTSGKRVTLENHRP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgtggaaaagtggggttgtgttcatcctggtattgaatgcagctgtgtgtcat
gtgacgaccctggaaggagagctcgctgattctatttctggcaacttcctggacccaatc
aaagacttgctcaacgacagggatgacagcaaccaaactgttgccagattctccctccgg
aaaccttcccatccagacgctgaccagtgctacatcgttcctggcagagctgacaccctg
gccgcctgcaccttcaaccgcacctccaaaaccttcatggttatccacggatggacgctg
agcggcatgttcgagagctgggtgtcgaagctggtgtcggcgctttatgagagggagcac
ggcgccaacgtcatcgtggtggactggctcacgttggcgcagaaccactacgtgctggca
gctcagaaaaccaaagcggtggggcaggagatcgctcgcttcatcgactggattgaggaa
tccaccaatgccccggttgagaacatccatctgattggctacagcctcggtgctcatgtg
gcgggatttgccggcagccacgtgaccaataaagttgggaggataactggtctggatccg
gctggcccagactttgaggggatgcacgcacacagacgcctctcgccggacgatgctcac
ttcgtggacgtgctccacaccttcacacggggctccctgggtctcagcatcgggatccag
cagcctgtcggtcatgtcgacatttaccccaacggaggcagcttccagccaggctgcaac
ctcaggggcactctggagaagatcgctaactttgggatatttgccatcaccgacgccgtg
aagtgcgaacacgagcgctccgtccacctcttcatcgactccctactgaatgagcaggat
gcggcccaggcctaccggtgcagcagcagccaaacatttaaccgcggaatgtgcctcagt
tgccgcaagagccgctgcaacacggtgggctacgacatcagcaaagtccgcaaggcgcgc
aacgttcagatgtacaccaagacgcgagcgaccatgcctttcagagtttatcactatcag
ctgaagatccacttttccagtaaagtgaaccgctcggagatggagccctcgctcaccgtc
tccctgtatgggaccaaaggagaggccgaaaacctggagctcaaactgaaggagaaaatc
gcagtaaataagacacattccttcctgctggtgacggagaaagacgtcggggatctgctg
atgctgacgttcaaatgggaggaaacaaacagttggtcctcctccaggttgctgaaaatg
gtgtcgtcttggtgggggggcgactcgggcggcgccgacgtgcaggttcacaagatccgc
gttcgagccggagagacccagcagaagatggtgttctgtgtaaaaaaccccgacgttcag
aatttaatgcgggaggtcacatttgttagatgcaaggatgcctggaggacatctgggaaa
agagtcactctggagaaccacaggccttga

DBGET integrated database retrieval system