KEGG   Takifugu rubripes (torafugu): 101068715Help
Entry
101068715         CDS       T02386                                 

Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04068  FoxO signaling pathway
tru04218  Cellular senescence
tru04261  Adrenergic signaling in cardiomyocytes
tru04370  VEGF signaling pathway
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04625  C-type lectin receptor signaling pathway
tru04912  GnRH signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04933  AGE-RAGE signaling pathway in diabetic complications
tru05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101068715
   04370 VEGF signaling pathway
    101068715
   04068 FoxO signaling pathway
    101068715
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101068715
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101068715
   04621 NOD-like receptor signaling pathway
    101068715
   04622 RIG-I-like receptor signaling pathway
    101068715
   04625 C-type lectin receptor signaling pathway
    101068715
  09152 Endocrine system
   04912 GnRH signaling pathway
    101068715
   04914 Progesterone-mediated oocyte maturation
    101068715
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101068715
  09158 Development and regeneration
   04361 Axon regeneration
    101068715
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101068715
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101068715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101068715
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101068715
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101068715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 101068715
NCBI-ProteinID: XP_011611817
Position
18
AA seq 357 aa AA seqDB search
MALRSRTGFYRQEVNRTVWEVPERYRDLRQIGTGAYGTVCSAWDRRSGSQVAIKKLQRPF
QSKLFAKRAYRELRLLKHMKHENVIGLLDVFTAEVXLDRLRDFYLVMPFMGTDLGKLMKV
ERLTEERVQFLVYQMLRGLKYIHSAGIIHRDLKPGNLAINPDCELKILDFGLARQADAEM
TGYVVTRWYRAPEVILNWMHYTQTVDIWSAGCIMAEMLLGRPLFKGNDHLDQLREIMKVT
GTPTGDFVVKLRSQDAKNYIRSLPKVPKKDLHSIFSKSSSNAVCVLEKMLLLDPEERVSA
SEALDLDFFSEFRDVDEETEALPYDQTLDNTDLQLDQWKRHTFTEILTFRPARETPL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcgctccaggaccgggttctatcggcaggaggtcaaccgaaccgtgtgggag
gttccggagaggtaccgggacctgaggcagatcggaactggagcctacggaaccgtgtgc
tcagcctgggaccggcgctcggggtcacaggtcgccatcaagaagctgcagcgcccgttc
cagtccaagctcttcgccaagcgggcgtacagggagctgcgtctgctcaagcacatgaag
cacgaaaacgtgatcgggctgctggacgtcttcaccgccgaggtgntcctggaccgcctg
cgggacttctacctggtgatgccgttcatgggcaccgacctggggaagctgatgaaggtg
gagcggctgacggaagagcgggtgcagttcctcgtctatcagatgctcagaggactcaag
tacatccactctgcagggatcatccacagggacctcaaaccaggaaatctggccataaat
ccagactgtgagctaaagatcctggattttgggctggcgaggcaggcggacgcagagatg
accggttacgttgtgacccgctggtaccgagcgcctgaggtcatcctcaactggatgcac
tacacacaaaccgtggatatttggtcggctggttgcatcatggcggagatgctgctggga
aggccgctgtttaagggaaacgaccacctggatcagctccgggagatcatgaaggtcacg
ggaacgccgacgggtgactttgtggtgaagctacggagccaagatgctaaaaactacatc
aggagtcttcccaaagtgcccaagaaagatttgcactccattttttcaaaatccagctca
aacgccgtgtgcgtcctggaaaagatgctgctcctggaccccgaggagcgggtcagcgcc
tccgaggctctcgatctcgatttcttcagcgagttcagagacgttgatgaggagacggaa
gcgctgccgtacgatcagaccctggacaacaccgacctgcagctggaccagtggaaacgt
cacacgttcacagaaatactgaccttcagaccagccagagagacgcccctttaa

DBGET integrated database retrieval system