KEGG   Takifugu rubripes (torafugu): 101068956Help
Entry
101068956         CDS       T02386                                 

Gene name
htr4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04020  Calcium signaling pathway
tru04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101068956 (htr4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101068956 (htr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tru04030]
    101068956 (htr4)
G protein-coupled receptors [BR:tru04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101068956 (htr4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF621 Git3
Motif
Other DBs
NCBI-GeneID: 101068956
NCBI-ProteinID: XP_029703045
Ensembl: ENSTRUG00000001258
Position
14
AA seq 450 aa AA seqDB search
MKVEEPPDQGHMTSWCCRFDPPETSWCYSVFRLTPAVSLHPSRLPGNPNWCWTDVAQIHP
EAFRSDSMPTRMVLICFLSLVMLMSILGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLL
VSVLVMPFGAIELVHQHWIYGETFCLVRTSLDVLLTTASILNLCCIALDRYYAICCQPLV
YRNKMTPMRVALMIGGCWVIPTFISFLPIMQGWNSIGIDHVIEERRHSEGSNSTSCVFMV
NKPYALTCSVVAFYIPLVLMVLAYQRIYVTARAHALQISMLQRAGGAGGSSPGPSGVAAG
SSSDSADHQRNHRMRTETKAAKTLCIIMGCFCLCWAPFFITNVVDPFIDYTVPDKLWAAC
LWLGYINSMLNPILYAFLNKSFRRAFLIILCCGRSRYRRPSILGPRAPRTATQITSSTHV
LRYSVLHNGNHADQEKKCLHGNTESYESCL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggaggaaccaccagaccagggtcacatgacttcatggtgctgcagatttgat
ccacctgaaacttcctggtgctattcagtgttccgtctcacaccagcagtttcactccat
cccagcaggttgcccggcaacccaaactggtgctggactgatgtggcccagattcatccc
gaagccttcagaagtgacagcatgcccacgcgcatggtcctgatctgcttcctgtctctg
gtcatgctgatgagcatcctggggaacctgctggtcatggtggccgtctgcaaggacaga
caactcaggaagatcaagaccaactacttcatcgtgtctctggcctttgccgacctgctg
gtctcggttctggtgatgccttttggtgccatcgagctggtccaccagcactggatctat
ggggagaccttctgcctggtccggacgtcgctggacgtcctcctgaccacagcgtccata
ttgaacctgtgttgcatcgccctggacaggtactacgccatctgctgccagcctctggtc
tatcgtaacaaaatgacgcccatgcgagtggctctgatgatcggcggatgttgggtcatc
cccaccttcatctccttcctgcccatcatgcagggctggaacagcatcggcatcgaccac
gtgatcgaggagcggcgccacagcgagggcagtaactccacttcctgtgtcttcatggtc
aacaagccctacgcgctcacctgctccgtggtggccttctacatccctctggtcctcatg
gtgctggcttaccagaggatctacgtcacggcccgagctcacgccctgcagatcagcatg
ctgcagcgggcgggcggcgcggggggcagctcgccgggcccgtccggcgtggccgcgggc
tcgtcatcagactctgccgaccatcagcggaaccaccgcatgcgaacagaaaccaaggca
gcaaagaccctgtgcatcatcatgggctgcttctgcctgtgctgggcgccgttcttcatc
accaacgtggtggaccccttcatagactacacggtgccggacaagctgtgggcggcctgc
ctgtggctgggctacatcaactccatgctcaaccccatcctctacgccttcctcaacaag
tccttccgccgtgccttcctcatcatcctttgctgcgggaggagccgctaccgaagaccg
tccatcctgggcccccgcgccccccgcacagccactcagatcaccagctccacacacgtc
ctcaggtattctgtccttcacaatgggaatcacgcagaccaggagaaaaagtgtctccac
ggcaacacagagtcgtacgagtcctgcttgtga

DBGET integrated database retrieval system