KEGG   Takifugu rubripes (torafugu): 101069476
Entry
101069476         CDS       T02386                                 

Gene name
mecom
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X4
  KO
K04462  ecotropic virus integration site 1 protein
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101069476 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101069476 (mecom)
Transcription factors [BR:tru03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101069476 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED zf-C2H2_11 zf-met PyrI_C
Other DBs
NCBI-GeneID: 101069476
NCBI-ProteinID: XP_011616374
Position
11
AA seq 1229 aa
MRSKGRARKLAMSNGEEELLLYPADYLDAVCSSGGDAALSLNTADDPTLDDDSSSKESLS
FQHQSLLLPKDLTIPLDFELRESGVPGRRLGIWSCRRINIGECFGPYQGERWTVRQSPTR
DFEVPGRVKFSADANKPDLGSWLMYIQFASFAQQHNLTLCQVDDQIFYKASREILPGEEL
LLFMKAEDFPCDNMAPDIHEERQYHCEDCNQHFESLNQLLDHQQKQPCGMPPSSDLNPGD
SDQKAQNPQDLQPLHIPHGPHECKECDQVFPNLKSLETHTLCHSEEREYKCDQCPKAFNW
KSNLIRHQMSHDSGKHYECENCSKVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSG
LKQHKHIHSSVKPFMCEVCHKAYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNK
HRRFCEGKNHFTAGGLFAQGMPLPGGPGLDKSALAMGHSASGMTEYLGATRHHSGFTFPA
ATAFPLSLPGLFSSGLYHRPPLIPTTSSVIQPAHAHGHSTELSKSPLLPPSPGVQEYQDL
LKAFHKHEGMPRNHMSDWHDQRFSSSTKQHSDQSDSDLDEVSTPSGSDLESTSGSELESD
MDSERAGAEENGKGLKRKVGEGNHKCSNLTGRSTAKEFPEPPIIPSYFDNHTAVTGAVND
SIKAIASIAEKYFGSTGLAGRQDKKRGGLPYPSMFPLQFFPAFSPPVYPFPDMDLRPTGP
KSEPRSKVDNCKKTAIKDTTESPFDLTTKRKEEISSTFGPSKPDALHTLGLDQPLDLSLG
TRTRGRCVREAEAKTNQDNGEQTAAVDIPKADASLQHARPTPFFMDPIYRVEKRRMSDPY
EALKDKYMQPASGFLFHPQLSAVGNMADKLETFGSLNVPGDRLHSVPSVFDFRVPTSSLS
ESLLRKGKERYACRYCGKIFPRSANLTRHLRTHTGEQPYRCKFCDRSFSISSNLQRHIRN
IHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGSLSGTAMSSPHSEVDNCGAVLDDKEDS
YFNEIKNFISNTGQNQMSPGSSEEGITGDAPEEKALMGTRSSCELEAAKLCGEVGMVEEA
SNTSAKAEGKLLSSCLNEDVQEEIDLSKTSGNDFAVNCKTSQRGYEKEEQDSNSGLDHIH
HISEMCKLEENKLNEGDRDETEGSFGSITLSEAINQPLFKKSKSQAYTMMLSLTDKDPLQ
PSSYSPSAMWHSLAQAASETSLVQSFSHV
NT seq 3690 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccatgagtaacggggaagaggagttgctg
ctttacccagctgactacctggatgccgtctgtagctcgggtggggatgctgccctttct
ttgaacacggcagatgacccaacgttggatgatgattcttcttccaaggaatcgttgtcc
ttccaacaccagagcctcctgcttcccaaagatctgaccattcctttggactttgagctg
cgagagtcaggggttcctgggaggcgcctaggaatctggagctgccggagaatcaacatc
ggggagtgctttgggccatatcaaggggaacgctggacggtccgtcaaagtcccactcga
gattttgaggtcccgggccgtgtgaaattttccgcggatgccaacaaacctgatctcggg
agctggctgatgtacatccagtttgcgtctttcgcccagcagcacaacctgaccctttgc
caggtagatgatcagatcttctacaaagccagcagagagattttaccaggtgaagagctt
cttcttttcatgaaggctgaagattttccttgtgacaacatggccccagatattcatgag
gagaggcagtaccactgtgaggactgcaaccagcactttgaatcccttaaccagttgctt
gaccaccagcagaagcagccatgtggaatgcccccttcctctgaccttaacccaggggat
agtgaccagaaggctcagaatccacaagacctgcaacctctccacattccccacggtccc
catgagtgtaaggaatgtgaccaggtgtttcccaacctcaagagtctggagacccacacg
ctgtgtcactctgaggagagggaatataaatgcgaccagtgtccaaaggccttcaactgg
aaatccaacctcatccgacatcagatgtcacatgatagcggcaagcactatgaatgtgaa
aactgctcaaaggtgttcacagaccccagtaatctgcagaggcacattcgctcgcagcac
gttggcgcgagggcccacgcctgctccgactgcggaaagacattcgcaacgtcttcaggc
ctcaagcagcataagcacatccacagcagtgtcaaaccattcatgtgtgaggtatgccac
aaggcttacactcagttctctaacctgtgccgccacaaacgtatgcatgcagactgccgt
acacagatcaagtgcaaggattgtgggcagatgtttagcaccacatcttccctcaacaag
caccgtcgtttctgcgaaggaaaaaatcatttcacagctggggggttgtttgctcagggt
atgccacttcccggtggccctggcttggacaaatcggctctagcaatgggccatagcgct
agcgggatgactgaatacctgggagccacccgtcaccacagtggattcaccttccctgct
gctacggcgttccccctcagcttaccaggtctctttagttctggactgtaccaccggcca
ccgctcattccaaccacctcttcggtaatacagccagcccatgcacatggacacagtaca
gagttgagcaagagtccactgttgcctccaagtcctggagttcaagaataccaagatctc
cttaaagctttccataaacacgaaggcatgccaaggaaccacatgtcggactggcatgat
cagaggttctcatcttccacaaagcaacatagcgatcagtccgacagcgacctggatgag
gtcagcacacccagtgggagtgacctagagagcacatcgggctccgagctggagagtgac
atggacagtgaaagggcgggtgctgaagaaaatggcaaaggcctaaagaggaaggtcggt
gaagggaaccataaatgctcgaacctgactggtagaagcactgctaaagagtttcctgag
cctcctatcatcccttcctattttgacaaccacacagcagtaacaggcgctgtgaacgac
tccatcaaagccattgcttcaatagccgagaagtactttggctccacaggacttgctggc
agacaagacaaaaaaagggggggtctgccctacccttctatgttcccactacagtttttt
cctgcattctctcctccagtttaccctttcccagatatggacctcaggcctactggcccc
aagagcgagccacggtctaaagtcgataactgtaagaagaccgcgatcaaagacacaact
gagtctccatttgacctcacaactaaacggaaggaggaaatatcatccacatttggtccc
tctaaaccagacgccttgcacacccttggccttgaccagccattagacctgagcctgggc
accaggaccagagggcgctgtgtaagagaggcagaagcaaaaaccaaccaggataatgga
gaacagacggcagcggtagacattccaaaagctgacgcgtctttgcagcatgccaggccc
accccttttttcatggaccctatctacagggttgagaagaggagaatgagtgacccatat
gaggctctgaaggacaagtacatgcagccggcatcaggctttctcttccatccacagctc
tcggctgtcggaaacatggctgacaagctggagacgttcggctccttgaacgtgccggga
gaccgtctgcattctgtcccttcagtctttgacttccgagtcccaacctcgtccctctcg
gagagtctactgcgcaaaggcaaggagcgctacgcatgcagatattgtggaaagattttt
ccccgctctgctaacctgacccgtcacctccggacacacacaggagagcaaccttacagg
tgtaaattctgcgatcgctccttcagcatctcctccaatctccagcgtcacattcgtaac
atccacaacaaagaaaaacccttcaagtgccacttgtgcgatcgctgtttcggtcagcag
accaatctggaccgccaccttaagaagcacgaaaacggcagtctgtcaggcacggccatg
tcgtccccacactctgaagttgacaactgcggtgccgttttggatgataaagaagattct
tattttaatgaaataaagaatttcatcagcaacacaggccagaaccagatgtcaccaggc
tcctcagaggaagggattaccggggatgcacctgaggagaaggcgctgatgggaactcgt
agttcatgtgagctggaagcagcgaagctgtgtggggaggtcggaatggtggaggaggcc
agcaacacatctgctaaagcagaaggaaagctactgtcgagctgcctcaatgaggacgta
caagaggaaatagacctcagcaagacctcaggaaatgactttgcagttaactgcaaaaca
tctcaaaggggatatgagaaggaggagcaggacagcaattcaggattggatcatattcat
cacatttcagaaatgtgcaagctggaggagaacaagctgaatgagggagacagagacgaa
actgagggctcctttggctccatcaccctgagtgaagccatcaatcagccgctctttaaa
aaatccaagtctcaggcatacaccatgatgctctctctcaccgataaggaccctctgcag
ccatcttcctacagcccttccgctatgtggcacagtctggcgcaggctgccagtgaaacc
agtctggtccagtcctttagccatgtatga

DBGET integrated database retrieval system