KEGG   Takifugu rubripes (torafugu): 101069540Help
Entry
101069540         CDS       T02386                                 

Definition
(RefSeq) complement factor B-like isoform X1
  KO
K01335  complement factor B [EC:3.4.21.47]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tru01002]
    101069540
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.47  alternative-complement-pathway C3/C5 convertase
     101069540
Peptidases and inhibitors [BR:tru01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101069540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Trypsin VWA HRM VWA_2 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 101069540
NCBI-ProteinID: XP_011609939
Position
15
AA seq 758 aa AA seqDB search
MGTSVRWSCFAALFSLLFMGQVWCDCTEENVGIEGGHYKLTREQQPGSMLIYYCPEGYFP
YPALTRTCQKNGAWKPALKRFPPQTCRLVECPDPSVLEYGTVSPPQERYFVDNETTYECD
SGYTLRGSSRRVCLPNGKWSGSTPICSRDTGHCADPGIPAGAARTGNLFETGAMVNYSCN
NELFLVGSSERTCLQSGEWSGIEPACYFKHTYDSPLEVSRVFGSAIKHHLTNPELVDDTQ
EGRRIKISKTGKLNIYIAVDISPSMDKQSISEAIALTLTLIEKISSFVVTPNYEIILFAR
DVFEVVNIMDFRSGKIPLVTVMDKLRSFNIDDRDTFIKDTDLNFAFKTFLERITSVKQQV
GDEAFKEERHVLIFFTDGAYNMGEPAPTVQKIKNLVYTNSMTEGGTQSTEENLDIYIFAT
GVEPFDEDLQPLTVGDNDKHYFRIKDIRNVHELLQGIIDDEEVMGLCGLHIEDDWNRRRM
YPWAAFIFIMNEVTMTKCLGSLVSPQFVLTAAHCLTFGTLPEHITVEIDDGAGKLKKVKT
VIIHPSYNINARAALGVREYYDYDVALIQLETDIDISYGARPICIPCTKETSNALQMADN
STCAQQEQILLRSQLEKLSFLTRKSKYIDKKEVHAKLGDNRNECIRHALQAEGITTTDPR
VAVSDNFLCTGGQTPYRDHIACAGDRGGAVFKEYKHRTIQVALVSWGNKLLCLRGGLVES
DQSSRDFHINLFRVVPFLKSVLGNDTQDEYAPLRFLDG
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggggacttctgtccgatggagctgctttgctgcactttttagtctccttttcatgggg
caagtttggtgtgattgcacagaagaaaatgtggggatagaaggaggccattacaaactg
accagggagcagcagcctggcagcatgctgatctactactgccctgaggggtacttcccg
taccctgctctgacgagaacctgccaaaaaaatggcgcctggaaaccagcgctcaagaga
tttccccctcagacgtgcagactggttgagtgtcctgaccccagcgttttggagtacggg
accgtctcccctccccaggaaaggtactttgtggacaatgagaccacctatgagtgcgac
tctggatacacgctgcgaggctcgtccagacgcgtctgcttaccaaacgggaagtggagc
ggctccactcccatctgcagccgtgacacgggccactgtgctgatcccggtatcccagct
ggagccgcaagaactgggaatctgtttgaaactggcgcaatggtgaattacagctgcaac
aacgagctgtttttggtgggctccagcgaaaggacgtgtttacagagcggtgaatggtcg
ggcattgaaccagcatgttacttcaaacacacctacgactcacctttggaggtttcacgg
gtatttggcagcgcaattaaacatcacctcactaatccagagctggttgatgatacacag
gaagggagaagaatcaagatttcaaaaactgggaaacttaatatttacatcgctgtggac
atttctcccagcatggacaagcagagcatcagtgaagccattgctttaactctcaccctt
attgaaaagatttcatcctttgtcgtgacgccaaattatgaaataatcttgttcgcacgg
gacgttttcgaagttgtcaacatcatggatttccggagtggcaaaatccccctggtgacc
gtaatggataaactgagaagctttaacatcgatgacagagacacgtttataaaagacacg
gatctgaactttgcttttaaaacctttctggagcgaatcacttcagtgaagcagcaggtt
ggagacgaggcctttaaggaggaacgtcacgtcttgatcttctttacagacggtgcgtac
aatatgggcgaaccggcccccaccgtacaaaaaataaagaacctggtgtacacaaacagc
atgactgaaggggggactcagtcaacagaagaaaatctcgacatttatatttttgccacc
ggagtggagccctttgatgaggaccttcagcccctgacagtgggagacaatgacaagcat
tacttcagaataaaagacattagaaatgtccacgagctcctccaaggaatcattgacgat
gaagaagtgatgggtctgtgtggtcttcacatcgaggatgattggaacagaaggagaatg
tatccatgggcggcgtttatcttcatcatgaatgaagtaaccatgacgaaatgcctcggc
tctctggtgtccccccagtttgtgttaacagctgctcactgcttgacttttggaacacta
cctgaacacatcaccgtggagatcgatgacggagctggcaaattgaaaaaagttaaaacg
gtgatcatacatcccagctacaacattaatgccagagcagcactgggggtgagggagtac
tacgactatgatgtggctctcatccagctggagactgacattgacatctcatatggtgcg
aggcccatttgcataccctgcaccaaggagaccagcaatgctctccagatggccgacaac
tctacctgtgcacaacaagagcaaattctgttgaggtctcaactggaaaagctctccttc
ctgacccgaaaatccaaatacatagacaaaaaagaagtccacgctaaacttggtgacaat
aggaatgaatgcatccgacacgcattacaggccgaaggaataacaacaaccgatcccagg
gtcgctgtgtccgataacttcctgtgcactggcggtcagactccttacagagatcatata
gcatgtgcaggtgacagaggcggtgccgttttcaaggaatacaaacatcgcacaatacag
gttgcactggtcagctggggaaacaagttgctgtgcttgagaggtggtctcgtcgagtcc
gatcagagctccagagatttccacattaatcttttcagggtggttccatttctgaagtct
gtcctcggcaacgacacccaggatgaatacgcgccgttacggtttttggatggttaa

DBGET integrated database retrieval system