KEGG   Takifugu rubripes (torafugu): 101069778
Entry
101069778         CDS       T02386                                 

Definition
(RefSeq) retinol dehydrogenase 5-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101069778
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101069778
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR NAD_binding_10
Other DBs
NCBI-GeneID: 101069778
NCBI-ProteinID: XP_003973175
Position
19
AA seq 332 aa
MDTQFFYDLLGENACLYTCGTLVVLWILVWLYRDSLEIEGIPDKYVFVTGCDSGFGNLLC
RKLDRRGFHVLAGCFTEKGADDLKRAAGPNLKTVLLNVTNEESIQKAMEWAKKEVGEKGL
WGIVNNAGSSLPMGPSEWMKVEDFQRTLKVNMNGVIAMTMAFLPLIKKARGRIVNVASVL
GRVAANGGGYCISKFAVEGFSDCLRRDLHYFGINVCIIEPGFFKTAVTSLDPLERELHRL
WNQLSPEVKATYGDKYLDKYIKVQRLIMNAVCDSDLSKVTNCMEHALTAAHPRSRYSAGW
DAKLLWIPLSYMPACVVDIGLKLVLPRPSKCA
NT seq 999 nt   +upstreamnt  +downstreamnt
atggatacacagtttttctacgaccttttaggggaaaatgcttgcttgtacacctgcggt
accttggtggtcctgtggatcctcgtctggctgtacagagacagcctggagatcgagggc
atccccgacaagtacgtgtttgtgactggctgtgactcaggatttggaaaccttctgtgt
aggaagctggatcgtagaggtttccatgtgttggctggctgcttcaccgagaagggagcc
gatgacctgaagagggcggcgggacctaatttaaaaacagtcctgctgaacgtgacgaac
gaggagagcatccagaaagccatggagtgggccaagaaggaggtcggggaaaagggactt
tggggaattgtgaacaatgctggaagctctttgcccatgggtccctcagagtggatgaaa
gtggaggatttccagcgcacactcaaggtcaacatgaatggagtgattgccatgaccatg
gccttcctgcccctcatcaaaaaggcccgcgggcgtattgttaatgtggcatcagtgctg
ggcagggtcgctgcaaatggaggaggatactgcatctccaaatttgcagtggagggtttc
tctgactgcctcaggagagatttacactactttggaatcaacgtctgcatcatcgagcca
ggcttcttcaagacagcagtgacgagcctggatcccctggagagggagctgcatcgcctc
tggaaccagctcagccctgaagtcaaggccacatatggggacaagtaccttgataagtac
atcaaggtgcagcgcttgatcatgaatgctgtgtgtgactcggacctgagcaaggtgacc
aactgcatggagcatgctctgaccgccgcccacccgcgctccaggtacagcgccggctgg
gatgcaaagctcctctggatccccctgtcttacatgcccgcctgtgtggttgatatcggg
ctgaaactggtgctgccccgtccctcaaagtgcgcgtaa

DBGET integrated database retrieval system