KEGG   Takifugu rubripes (torafugu): 101070472Help
Entry
101070472         CDS       T02386                                 

Gene name
rock1
Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04270  Vascular smooth muscle contraction
tru04350  TGF-beta signaling pathway
tru04510  Focal adhesion
tru04530  Tight junction
tru04810  Regulation of actin cytoskeleton
tru05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101070472 (rock1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101070472 (rock1)
   04530 Tight junction
    101070472 (rock1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101070472 (rock1)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101070472 (rock1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101070472 (rock1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101070472 (rock1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tru03036]
    101070472 (rock1)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101070472 (rock1)
Protein kinases [BR:tru01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101070472 (rock1)
Chromosome and associated proteins [BR:tru03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101070472 (rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding PH C1_1 Cortex-I_coil Pkinase_C HR1 Filament APH
Motif
Other DBs
NCBI-GeneID: 101070472
NCBI-ProteinID: XP_011614483
Ensembl: ENSTRUG00000013281
UniProt: H2UA39
Position
22
AA seq 1381 aa AA seqDB search
MSSGESMDVRFEKIDAMLTDPKSEINTDCLLDGLDALVYDLDFPALRKNKSIDNFLNRYK
ETINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKFTSKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFADSSWVVQLFFAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHSMGFIHRDVKPDNMLLDKTGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALTFP
DDSDISNDAKNLICAFLTDREVRLGRNGVDEIKRHPFFKNDQWTWENIRDTAAPVVPELS
SDIDTSNFDDIEEDRGEEETFPVPKAFVGNQLPFVGFTYYSNQHPLRRPSTASKASDKRG
STTKEDKSHLENLQKRIYQLEEQLHSEMQLKDELEQKCRASHTKLEKIMKELDEEANIRK
NTEASVSLLEKDKIMLQHRFTEYQRKADQEAEKRRNLENEASTLKEQLEDMRKISQNSQA
SNDKIIQLQNQLEEANDLLRAESDTAARLRKNHTEMAKSMSQLESLNRELQERSRAIDGE
KAQLEKEVLVIQSTLDSERRNYSQGSEEIRELQARMAGLQEDNKSLKLSLSKVEAERKQA
QERSNNLEKEKNNLEIDLNYKLKTLQQRLEQEQTEHRVTRAQLTDKYESIEEAKSAAMNA
VQQKMSEEIGARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVKSLRIQ
AEQELSKRVLAQSELKSCMQEVDRLRCSEKQLKQEINTALESKRSLEFQLAQLTKQYRGN
EGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEERNRQVQEAHKKMQELSSERDSLSAQL
DLTVTKAESEQLARALQEEQCFELSQENKKSVARHKMEIIEKEAIISRLEESNKTLTKDA
ENLSKEKAELNEKLQTQEQEYVDQKEDIVNAVKANYEKVLNTERTLKTQAVNKLAEIMNR
KDMKLDTKKKGSTTDLRKKEKENRKLQLELNQEKDKFNHMAIKYQKELSEMQAQLAEEFS
NRNELQMQLDSKESDIEQLREKLNDLQQRMDNSSITSLQTDETDSNIAESRLEGWLSIPN
RANIKRYGWKKQYVVVSSKKILFYNDEQNKEQSNPSMVLDIDKLFHVRPVTQGDVYRAET
EEIPRIFQILYANEGECRKEADMEPVLQGDKTNCLPHKGHEFIPTLYHFPSNCEACAKPL
WHVFKPPAALECRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLLALTQDEQKKWI
GHLGKKIPKTPPSTFSRASPRSMSTRSGPNQSFRKNPKSNTGKLSRAQSSLQAADTTSST
C
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctggggaaagcatggatgttcgattcgaaaaaatcgatgccatgctgactgat
ccaaagtcggaaataaacacggattgtcttctggacggcttggacgcactggtgtatgat
ctggacttcccagccctgcggaaaaacaagagcatcgacaactttttgaatagatataaa
gaaaccatcaataaaatccgggatctgcgcatgaaagcagaggactatgaggttgtcaaa
gttatagggaggggagcgtttggagaggtccaactggtgaggcacaaattcacaagcaag
gtttatgcgatgaagctactaagtaagtttgagatgatcaagaggtcggactccgctttc
ttttgggaggaaagggacatcatggcttttgcagacagctcctgggtggtacagctcttt
tttgcattccaagatgaccgctacctctacatggtgatggagtacatgccagggggtgac
ttggtgaatctgatgagcaactatgatgtcccagagaaatgggcgcgcttttacactgct
gaggtggtgctggctctggatggaatccactccatgggcttcatccacagggacgtgaag
cctgataacatgttgttagacaaaacaggccacttaaaactggctgactttgggacctgc
atgaaaatgaacaaggacggtatggtacgatgtgacacggcagtgggaactccagattat
atttcaccggaggtactgaagtcccagggaggcgatggatattacggcagagagtgtgac
tggtggtcagtgggagtattcctctatgaaatgctagtcggcgacacgcccttttatgca
gactctctggtgggaacctacagcaaaattatgaaccacaagaatgccctgaccttcccc
gatgacagcgacatatccaatgacgccaagaatctcatctgtgcttttctcactgacagg
gaggttcgacttggccgtaacggcgtagacgagataaagaggcatcctttcttcaagaat
gaccagtggacctgggaaaacatccgagacacggccgccccagtcgtgcctgaactgagc
agtgacatcgacaccagtaactttgatgacatcgaggaggatcggggtgaagaggagacc
ttcccggtaccaaaggcatttgtgggaaaccagctcccctttgtaggcttcacttactac
agcaatcagcaccctttgcggaggcccagcactgcctcaaaggccagtgacaaacgcggc
agtactacaaaagaggacaagagtcatctggagaacctgcagaaaaggatctaccagctg
gaggagcagcttcacagcgagatgcagctgaaggatgagttggagcagaaatgcagggca
tcacacaccaagcttgaaaagatcatgaaggaactggacgaagaggcaaacattagaaag
aatacagaggccagcgtgtctttgctggagaaggacaagatcatgctgcagcaccgattc
accgagtaccaaagaaaagctgaccaggaggcagagaagagacgcaacttggaaaatgag
gcgtcaactttaaaggagcagcttgaagatatgagaaagatcagccaaaactcacaggcc
tcaaatgacaaaattatccaactgcagaatcagttggaagaggccaacgacctcctgcgc
gcggagtcagacacggcagcaagattacggaaaaaccacacggaaatggccaagtccatg
agccagctggagagcttgaaccgggagctgcaggagaggagccgtgccatagatggagaa
aaggcccagttggagaaggaggtcctggtgattcaaagcaccctcgactcggagaggagg
aactacagccagggatctgaggagatcagggagcttcaagcaaggatggctgggttacaa
gaggacaacaaaagtctgaagctcagcctgtcaaaagtggaagccgaacgcaaacaagcc
caggagaggagcaacaacctggagaaggaaaagaacaacttggaaattgacctgaactac
aaactgaagactttgcaacagcgtctggagcaggaacagacggagcaccgggtgacgcgg
gcgcagctcaccgacaaatatgagtccatcgaagaagccaaatcagccgccatgaatgcc
gttcagcagaagatgtctgaagaaattggagcccgaatgcgagccgagagtcgggtagtg
gaagtggagaagcagtgctccatgttggagtttgacctcaagcagtctgttcagaagatg
gagcagctgatgaagcaaaaggaacgactggaagacgaggtgaagagcctgcgaatacag
gctgaacaggagctgagcaagcgcgtgctggctcagagcgagctgaagagctgcatgcag
gaggtggaccgcctcaggtgttctgagaagcagctcaaacaggagatcaacacggcgcta
gagagcaaacgctcactggagtttcagttggcacaactgacaaaacaatatagaggcaat
gaaggacagatgagggaacttcaggaccagcttgaagctgaacagtatttttccacgctt
tacaaaactcaggtcaaggagctaaaggaggagattgaagaaaggaatcggcaggtgcag
gaggctcataaaaagatgcaggagctgagcagtgaaagggactcgctatctgctcagctg
gatctgaccgtgaccaaagctgaatcggagcagctcgcccgtgctcttcaggaggagcag
tgctttgagctcagccaggagaataagaagtcagtggcgagacataagatggagattatt
gaaaaagaggctattatctcacggctcgaggaatccaataaaactctaaccaaagatgct
gaaaacctcagcaaagagaaggcggagttaaatgagaaacttcagactcaagaacaagag
tatgtagatcagaaagaagacattgtaaatgcagttaaggccaattatgaaaaggtccta
aacacagaacgcacgctgaagactcaggctgtaaacaagctggcagagatcatgaatcgc
aaggacatgaagctggacacgaagaagaagggcagcaccaccgacctgcggaagaaagag
aaggagaaccgcaagcttcaactggaactgaaccaggagaaggacaagtttaatcacatg
gccatcaagtaccagaaggagctaagcgagatgcaggcgcaattagcagaggagtttagt
aaccgcaacgagcttcaaatgcagctggacagcaaggagagtgacatcgagcagctccga
gagaagctgaacgacctgcagcagcgcatggacaactccagcatcaccagtctgcagaca
gatgagacggacagcaacatagcagagtccagattggagggttggctgtccattcctaac
cgcgctaatatcaagcgatatggatggaagaagcagtatgtggtggtgagcagtaagaag
attctcttctacaatgatgagcagaataaggaacagtccaacccctcaatggtactagat
atcgacaaattatttcatgtgagaccagttacacaaggagatgtatacagagctgagaca
gaggagattcccaggatattccagattctctacgccaacgagggagagtgcaggaaggag
gcggacatggagccggtcctccagggcgacaaaaccaactgtctcccgcacaaaggccac
gagttcatccccacgctatatcactttccttccaactgcgaggcctgtgccaaacccctg
tggcacgtcttcaagccgccggcggcattagagtgtcgccgctgccacgtcaagtgccac
aaggaccacctcgacaaaaaggaggacgttatagctccttgcaaagtaaactacgatgtg
acctctgcccgagacatgcttctactggccctcacccaagatgagcagaagaaatggatc
ggccacctcggaaagaagatccccaaaacgccaccctccacgttttcacgagcctcacct
cgttccatgtccactcgctccggaccaaaccagtccttccgcaagaaccctaaaagcaat
acaggaaagctgagcagagcgcagtccagcctccaggcagcagacacaacatccagcact
tgttga

DBGET integrated database retrieval system