KEGG   Takifugu rubripes (torafugu): 101070842Help
Entry
101070842         CDS       T02386                                 

Gene name
ccnh
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru03022  Basal transcription factors
tru03420  Nucleotide excision repair
tru04110  Cell cycle
Module
tru_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    101070842 (ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    101070842 (ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101070842 (ccnh)
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     101070842 (ccnh)
DNA repair and recombination proteins [BR:tru03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     101070842 (ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N
Motif
Other DBs
NCBI-GeneID: 101070842
NCBI-ProteinID: XP_003975085
Position
21
AA seq 319 aa AA seqDB search
MFHNSSHKRFWIFKSEDELEHMRCKANQKFRNKILESGKSGANESIFLERNEEDVLFRYY
ERRMLDFCNAFKPAMPKSVVGTGIMYFRRFYLNNSIMEYHPRIIMLTCAYLSCKVDEFNV
SSTQFVGNLVQESPAGQERVLEQILEYELLLIQQLNFHLVVHNPYRPLEGLLIDLKTRFP
TLENPESLRKSSDDFLTQAAITDAGLLFPPSQIALAAILNSALRAGLNLESYLTECLGLK
GDKEMLAKMYDSLRRIKILLKKYELPKAEEVNLYKHKLERNHAEFSTSSNKRKRGYEEDG
HVAKEPRLTEEEWTDEDLI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttccacaacagttcccacaaaaggttctggatctttaaaagtgaggatgagctggag
catatgcgctgcaaagcgaaccagaaattccgcaataagatcctggagagtgggaagtct
ggagccaatgaatccatatttctggagcggaatgaagaagacgttttattcagatactac
gagaggagaatgctggatttctgtaacgcatttaaaccagcaatgcccaaatctgtcgtg
ggtacagggatcatgtacttcagaagattctacctgaacaactccatcatggaataccat
cccaggattatcatgttgacgtgtgcgtacctgtcctgtaaagtggatgagttcaatgtg
tccagcacccagtttgtgggcaacctggttcaggagagcccggcggggcaggagagggtt
ctggagcagatcctggagtacgaacttctgctcatccaacagctcaactttcacctggtc
gtccacaacccctacagacccctggaggggctgctcattgacctcaagacacggttccct
acgctggagaacccagaatcgttgaggaagagctctgacgactttctgactcaggcagcc
atcaccgacgcgggactgctgttccctccgtctcagatcgccctggcagccatactcaac
agcgccttaagagccggtctcaacttggagagctacctgacagaatgtttggggttgaag
ggagataaagaaatgctcgcaaagatgtatgattcactacgacggataaaaatcctctta
aagaaatatgaacttcccaaggcagaggaggtaaacttatacaagcacaagctggagagg
aaccatgctgaattttccacatcgagcaataaaagaaaacgagggtacgaggaggacggc
cacgtcgccaaagaaccacgtctgacagaagaggagtggaccgatgaagacctgatttag

DBGET integrated database retrieval system