KEGG   Takifugu rubripes (torafugu): 101071419Help
Entry
101071419         CDS       T02386                                 

Gene name
parp9
Definition
(RefSeq) poly(ADP-ribose) polymerase family member 9
  KO
K15260  poly [ADP-ribose] polymerase 9 [EC:2.4.2.30]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101071419 (parp9)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     101071419 (parp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro
Motif
Other DBs
NCBI-GeneID: 101071419
NCBI-ProteinID: XP_003962141
Position
1
AA seq 755 aa AA seqDB search
MASLFDIPLDGPSFTIWKSCELFLNDILQSKFGCVAIVSGTASEGYRSVMPIKKPAPVSE
KRFEALVSGVKVSVHKADLSNFPVDAVVNAANEGLQHIGGIALALSKAGGPQIQEDSDEH
VRKFDVLKTGEAIALPARLLPCKVIIHAVGPKISRHSPPNFRQAEQLLDSAVLNSLRRAE
ECHLKSVALPAISSGLFGYPLPQCADSIVRSVRWFCEKSQVKYLKEILLVNIDDRTVTEM
EKACKRIFSTHSASSSAGNKTAKTYHSSTHTVQLGTVQLTLKQGQIEEQQTDVIVNTAVK
DCWNSGQISRAILKKAGPKMEEELKSTRAANGSIITTGPYNLHCTEVYHALCISKFNHKA
HQILSNAVSECLQSAAAKSHQSISFPAIGTGGLNFEREEVAQIMTTAVLEFAKNSSKKME
VYFVIYPSDHNTFKAFEDRMRSLQLETFNPPPTKAVTEQQDDGMGDSTAKLSVSGSSEES
RQEAYAWLSDILIHRRVMREIQNNFITHFGEEEYLQLTKIICQNNVAIEEFLNQGVARLI
LNGDFIVNVAVACLAVENMLCKIQKDFVNEEAKLLSSYTNTNLQYERREIPNPRSHFLAT
DFRSAGLEIVKIKSVENPTLRMIFGLKKNQMKSFTTRRMLQRIPAHFCDMVSHIGFQAEF
APPDEPAQGQGIYFTGKVSTAMNIWSQAVSEYIYFVEADVLTGKSAPGKPDLILPPPVDV
DPLVRYDSLSGGGDISVIFTGYQALPLHIITCKKT
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggccagtctgtttgatattcccctagatggaccttcattcaccatttggaaaagttgt
gaattgtttctgaatgatattcttcaaagcaaatttggatgtgtggccatcgtcagtggc
acggcgtccgaaggctaccggtccgttatgccgattaaaaaaccagcccccgtctcggaa
aagaggttcgaggcgctcgtttcaggggtgaaggtgtcggtccacaaagcagatcttagc
aatttccctgtggatgctgtcgtcaatgcggctaatgaaggccttcaacatattggtggc
attgctctggctctctctaaagccggaggtccccaaattcaagaggacagcgatgaacat
gtcagaaagtttgatgtcttgaaaacaggcgaggcgattgctctgcccgctagactttta
ccatgcaaagtaattatccatgcagtgggcccaaaaatatcacgccactccccgcctaat
ttccgtcaggctgaacagctcttggacagtgctgttttgaacagtcttaggagagcagag
gagtgccatctgaagtcagttgccctcccagcaataagctctggactgtttggctaccct
ttgccacagtgtgccgacagcatagtcagatctgtcagatggttttgtgagaaatcccaa
gtcaagtatctgaaggaaatcctactggtgaacatcgatgaccgaactgtgaccgaaatg
gagaaggcctgcaaaaggattttttctactcactcagccagcagctcagcaggaaacaag
actgcaaaaacctaccatagctcgacacacactgtccagttgggaactgtccagctgaca
ctgaagcagggtcaaattgaagagcagcagacggatgtgattgttaacacagcagtcaaa
gactgttggaacagtggtcaaatctccagggccatactgaagaaagctggcccgaagatg
gaagaagaacttaaaagcaccagggctgctaatggaagtatcatcaccacaggaccctac
aacctgcattgtacagaggtgtatcacgcgttgtgcatctctaagttcaatcacaaagcg
catcagattctttcaaatgcagtatcagaatgtctgcagtcggcggccgcaaagtcgcac
cagtcaatctcatttcccgccatcggcacaggaggcctgaactttgagagggaagaggtc
gcccagatcatgacaacggctgtgctcgagtttgcaaaaaattcttcgaagaagatggag
gtttattttgtgatataccccagtgatcacaatacatttaaggcttttgaagatcggatg
agatctctccagctagagactttcaaccccccacccacaaaggcagtgactgagcagcaa
gacgatgggatgggagattctactgcaaagctcagcgtgagtggttcctctgaggaatca
agacaagaggcttacgcgtggctctctgacatcctcattcatcgccgggtgatgagagag
atccagaacaacttcatcactcactttggggaagaagaatatctgcagcttaccaaaata
atctgccaaaataacgttgccatcgaggagtttttaaaccaaggcgtggcacgcctaatt
ttgaatggagatttcattgtaaatgtagcggttgcctgtttggcggtggagaacatgctt
tgtaagatccagaaggattttgtgaacgaggaggcgaagctgctctcaagttatacaaat
acaaacctgcagtatgaacgacgtgagattcccaatcccagatcacatttcttagcgacc
gacttccggtctgcaggcctggagattgttaagattaaaagtgtagagaatcctacactg
aggatgatctttggcctgaagaagaaccaaatgaaatcttttacaacccggagaatgctg
cagcgcatccctgcacacttctgtgatatggtcagccatatcggattccaggcagagttt
gcgccacctgatgaaccagcccagggacagggcatctacttcactggcaaagtgtcaaca
gccatgaacatctggagtcaggcagtttctgaatatatatattttgtggaggctgatgtg
ctgacaggaaagtctgcccctggtaaacctgacctgatcctgccacctcctgtggatgta
gacccgctggtccggtatgacagtctgagtggaggaggtgacatctctgtcatatttact
ggctatcaagctttgccccttcacatcatcacctgtaagaaaacataa

DBGET integrated database retrieval system