KEGG   Takifugu rubripes (torafugu): 101071810Help
Entry
101071810         CDS       T02386                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101071810
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tru04131]
    101071810
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tru04812]
    101071810
   04147 Exosome [BR:tru04147]
    101071810
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101071810
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   101071810
Membrane trafficking [BR:tru04131]
 Others
  Actin-binding proteins
   Others
    101071810
Cytoskeleton proteins [BR:tru04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     101071810
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101071810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Pur_ac_phosph_N fn3_2 ig Ig_2 fn3_4 Y_Y_Y SusE RL11D
Motif
Other DBs
NCBI-GeneID: 101071810
NCBI-ProteinID: XP_029697926
Position
9
AA seq 2122 aa AA seqDB search
MTPDINAQLPAKDSQSPCEVIVQGPSSASAQNRGATPNVKTEAAEMENAVKPKLQITFST
FTIKNGEVLKVEIPVVGHPAPKIEWQKNGQAVKETSRLEILNTSSLTVLHIRHSAREHAG
QYSITASNSAGKCTGEITVTVLEKPDPPKVPIRIDEVSSDFAVISWDPPEYTGGCQLDNY
IVEKRETTSTEWQTVSATTVRTTIKITKLKTGSEYQFRVFAENRYGKSSAITSPVVTAQY
PFSVPGAPGIPVATTVTKYSMVIEWEPPAMDGGSPITGYHLERKEKNSILWTKLNKLIIT
DARFKTSGLEEGIEYEFRVFAENIAGLSSPSKASESYVARDPCDPPGKPETVIITKDSVT
LQWSKPRHDGGSTITGYVVEKKELPDGRWMKANFTNIIENQFTVTGLTGGQGYEFRVTAK
NGAGVWSTPSESVTLIAQDVIEAPTAFIDPKFKMMVIAQAGETFIIDADYFGKPLPQVIW
LKDGKEIAKISPRMEIKNTLTHTTLTVRDCIRVDGGNFVLNLSNCGGTTSVPVNVRVLDR
PGPPDGPLKVKVVSAEKCNLHWNPPTHDGGASISHYVIEKRESSRVTWTGVESHVECVSY
KVNKLVPGKEYIFKIAAVNKFGVGEFLESDPFIAQNPFTTPAEPSTLSASSVTGDSVVLT
WERPETDGGSEIDGYILEKRDKEGVRWTKCNRRRLNDLRFRCTGLSEGHYYQFRVMAENA
AGVGPPSEPSEYVKVCEAVYPPGPPVNFKVTDYSPSTVSLTWSRPIYDGGAAINAFILEM
KEASEEEWITCSSSIGIEDTNYTVNRLRENTEHNFRLSAINAAGVGENVGLLRTVVTAEK
LEAPEIELDGTLRKIVNVRSCSTLRLVVSVKGRPQPEVKWSKEDGMLSERAQIEVTDSYT
VLMIENVKRDDTGKYVLTAENCSGSKSAFINVRVLDSPSAPTNLQVKDVKRDSLSISWEP
PLVDGGAKILHYIIEKREEARKTFTSVCSNCVRNSYKIDNLQEGSFYYFRVLAVNEFGTG
LPAETTEVVKMCEVPFPPGKITLSDVTCSGGRLSWEKPDNDGGSKITSYIVEIKTKEDDN
WITYSESKAVTVTLNGLARGREYFVRVSAVNEKGKSEPKSLVMPVIFKDTSAEPVFNLLS
NAFNVKSGNDLKIDVPFRAVPPPTVVWKKDGNLLKETCRVNANTSDTLTQIIIKDAIRTD
VGVYEVFLANSAGTASMEIHVNVFEKPEPPTDLSIDEVSADFMCLSWQPPRYTGGCQISN
YIVEKSDTTSTVWQTVSSTVARTSIKIGRLTHGTEYQFRIAAENRYGKSHFLESEPVIAQ
YPFKPPDQPNNIRIVNASKSFIMIAWSMPDNDGGSPIIGYHVECKDQSSILWTKLNKIPV
IDTQFKVANVDEGLVYEFRVCAENMAGIGPCSKASEAVAARDQCDPPRNLAVTNITTSSV
SLSWDRPEYDGGAKITGYIVECKVIPNGCWLKCNFTTLLDTFLDVTGLTEDEQYDFRVTA
KNAAELLSAPSETTGPVTVQHDVESPKITMEDKFRQVVVVKARDLLRIDADIYGRPNPTV
FWLKNGRNIGSKGRIEMTATKTHTSLLIRECVRKDSGQYTLTLQNPGGTISKMITCKVLD
RPGPPAGPLEVSGLSAEKCTLSWGPPHETGGAEILHYIVEKCETSRVSWIVMYSDMMATT
CKISKLFKGNEYLFRVRAVNKYGEGETLESEAVKATDPFTVPSAPTDVEVTSATSDTMTI
CWKRPETDGGSRISGYIIEKREKQGVRWVRVNKKLVYDQRAKASCLREGCEYEFRVFAEN
SAGLSEPSLPCPLTLAEDPKFLPSPPSKLSITDSSRSSITLSWNKPLFDGGAAVTGYKIE
YRKSTEEEWNVGVHNTDKTEFTVTGLSSGTQYVFTVRSINKIGISEPSPESDPQVAMERE
EEPRFDITADTRKTLLVKAGSSFTLTMPFTGKPVPSVTWEKADVDLRVRGMINTSSSVTS
ITLEGATRDDSGKYTVKLQNIAGSTCLTLNVRVLDSPGPPTHLTVKDVTKISATVSWDIP
ENEGGDPVKNYLVDIHDIRKKGWTRLTDKCRRLSYKVSDLEEGGIYFFRITAENEYGIGV
PAETKEGTKMTDTVDWETNLGA
NT seq 6369 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagatatcaatgcacagctgccagcaaaggattctcagtcaccctgtgaagtc
attgtccaaggtccttcctcagcttcggcacagaacagaggagccacaccaaatgtcaag
accgaagctgctgagatggaaaatgctgtcaagcccaaactccagataacttttagcaca
tttaccattaagaacggtgaagtactaaaggtagaaattccagtggtcggtcacccagca
cctaaaattgagtggcagaaaaatggccaggcagtcaaggagacatcaaggttagaaatt
ttaaatacgtcatcactaacggtccttcatatccgacacagtgccagggagcacgctggc
caatactctatcacagcgagcaacagtgctggaaaatgtacaggagaaatcactgtgact
gttcttgaaaagccagacccacccaaagtacctataaggatcgatgaggtcagttctgac
tttgctgtcatttcctgggatccaccggaatatactggaggctgtcagctggacaattac
attgtagagaaacgggaaactacaagtacagaatggcaaactgtgtcagcaacaacagta
agaacaactataaaaatcaccaaactgaagaccggcagtgagtaccagttcagagttttt
gcagaaaacaggtatggaaagagttcagccatcacatcccctgttgtaactgcacaatat
ccctttagtgtgcctggtgctcctggaataccagtggcaaccacagtcacaaagtacagt
atggtgattgaatgggagccacctgccatggatggaggcagtcccatcacaggctatcac
cttgaacgcaaagagaagaatagtattttatggaccaagctgaacaagctcattataaca
gatgctcgattcaagacaagtggactggaggaaggtattgagtatgaattcagagtcttt
gcagagaatattgctggacttagctcgcctagcaaggcatcggaatcttatgtggcaaga
gacccttgtgatccacccggcaaacctgaaactgttatcattacaaaagacagtgttaca
cttcagtggtcaaaacccaggcatgatggtggaagcacgattacggggtatgtcgttgaa
aagaaagagctcccggatggcagatggatgaaggcaaacttcacgaatatcatcgaaaat
cagttcacggtcactgggctgacaggaggacaaggttatgagtttagagtgacagctaag
aatggagccggggtgtggagcacaccttcagaaagtgtaaccctcatcgctcaggatgtc
attgaagcgcccacagcattcattgatcctaagtttaagatgatggtcatcgcgcaggct
ggtgaaaccttcattattgatgcagattactttggaaagcctcttcctcaagtaatatgg
ctaaaggatggaaaagaaattgcaaaaatttcaccaagaatggagatcaagaacacactc
acccatacaactctcactgtcagggactgtatacgagtggatgggggaaactttgtttta
aacctcagtaactgtggtggaaccacatctgtcccagttaatgtgagggtcctagataga
cctggacctcctgatggaccattgaaggtaaaggttgtcagtgcagaaaagtgtaatctt
cactggaaccctcctacacatgatggtggcgctagtatttctcactatgtcattgaaaaa
agggagagcagccgtgttacatggacaggagttgagtctcatgtagaatgtgttagttac
aaagtgaacaaacttgtccctggtaaagaatatatattcaaaattgctgctgttaataag
tttggtgttggtgaatttctggaatcagacccatttattgcccagaatccttttaccaca
cctgctgaaccttcaaccctttcagccagcagtgttactggtgactctgtggtgctgaca
tgggaaagacctgagactgatggtggctctgagattgatggctacatccttgaaaaacgt
gataaagagggtgtcaggtggaccaaatgcaacagaaggaggttgaatgatttgcggttt
cggtgtacaggtctttcagagggccactattatcagtttagggtgatggcagagaatgct
gccggtgtgggccctcctagtgagccaagcgagtatgtgaaggtttgtgaagctgtctac
ccacctggtcccccggtcaactttaaagtgacagattattcccccagtacagtgtctcta
acctggtcacggcctatctatgatggtggagcagctataaatgcattcatattagagatg
aaggaagcatctgaggaagaatggatcacctgttcatcaagcatagggattgaggacacc
aactacactgtaaatagactcagagaaaacacagagcacaattttcgcctaagtgcaata
aatgctgcgggcgtcggtgagaatgtgggtctgctaaggactgtggtgactgctgaaaag
ttggaagcgcctgagattgagctagatggaactttgaggaagattgtaaatgttcgatcc
tgttctacactacgacttgttgtcagtgtcaaagggcggccacaacctgaggtgaaatgg
tcaaaagaagatggtatgctgagcgagcgagctcagattgaggttacagactcctacaca
gtgttaatgattgagaatgttaaaagagatgacacaggaaaatatgtactgactgctgaa
aactgcagtggttctaaatcagcctttatcaatgtcagagttctggattctcccagtgca
ccaaccaacttacaggtaaaggatgtaaagagagactctttgtcgatttcctgggagccg
cctcttgttgatggaggagcgaagattttgcactatatcatagaaaaaagagaggaggcc
agaaagactttcacaagtgtctgcagtaactgtgtgaggaactcctacaagattgacaat
ctccaggaaggatccttctattatttccgtgttttagctgtgaatgaatttggtacagga
ctgcctgcagaaacaactgaggttgtcaaaatgtgtgaggttccttttcctccaggcaaa
atcactctgagtgatgttacctgtagtggtggaagactctcctgggagaaaccagacaat
gacggaggaagcaagatcacaagctatattgtagaaataaagaccaaggaagatgacaat
tggataacatattctgaaagcaaagcagtgacagtaactctgaatgggctggccagagga
agggagtattttgtcagagtcagtgctgtgaatgaaaaaggaaaaagtgagccaaaatcc
cttgtgatgcctgttatattcaaagatactagtgctgagcctgttttcaatttgctgtcc
aatgccttcaatgtgaagtcaggaaatgatctaaagattgacgttccattcagggctgtg
ccccctccaacagtagtctggaagaaagatggaaacttgctgaaagagacatgccgggta
aatgcaaatacatctgacactttgactcagatcattattaaagatgcaatcaggacagat
gtaggtgtatatgaggtgttcctggccaactcggcaggtactgcatctatggaaatccat
gtaaatgtatttgaaaaacccgagccgccaactgatcttagcattgacgaagtgagtgct
gacttcatgtgtttgtcatggcagcccccacgttatacaggcggatgtcaaattagcaat
tatatagtggagaagagtgataccaccagcacagtatggcaaacagtctcatctacggtt
gctaggacctcaataaaaattggtcgtctaacacatggcactgaatatcaatttcgtata
gctgcagagaatcgttatggcaaaagccactttttggaatctgagcctgttattgctcag
tatcccttcaagcctcctgatcaaccaaacaacattaggattgtgaatgcttcgaagtct
ttcatcatgatagcatggagcatgccggacaatgatggtggtagcccaataattggatat
cacgttgaatgcaaagatcagagcagcattttgtggacaaagttgaataaaatcccagtg
attgacactcagtttaaagtagccaatgttgatgaaggattggtttatgagtttcgggtc
tgcgcggagaatatggctggtattggaccatgcagtaaggcatcagaggccgtggcagcg
agagaccagtgtgatcccccacgtaacctcgcagtcaccaacataaccaccagctcagtt
tctctttcgtgggatagaccagaatatgatggtggggctaaaataaccggctacattgtt
gaatgcaaagtaataccaaatggctgctggctcaagtgcaactttaccaccttactggac
acctttttggatgtcactgggctcaccgaggatgaacagtatgattttcgtgtgactgcg
aaaaacgccgctgagcttctcagtgcaccgtctgaaactactgggcctgtgacagtgcag
catgacgtagagtcacctaaaattaccatggaggataaatttagacaggtggtagttgtc
aaagcaagggatctcctaagaatagatgctgatatctatggtcgcccaaaccccacagta
ttttggttaaagaatggcagaaatattggatccaaagggaggattgaaatgacagcaaca
aaaacacacacctctctacttatccgagaatgtgttaggaaagattctggacaatataca
ctgaccctacagaatccagggggtaccatatcaaaaatgatcacttgcaaagtcctggac
agaccagggccaccagcggggcctctggaagtatctggtctttctgcagagaaatgcact
ttgtcatggggacctcctcatgaaactggtggtgccgagatcctgcactacattgttgag
aagtgtgaaaccagccgtgtctcttggattgtcatgtatagtgacatgatggcaactacc
tgcaaaatatccaagctgttcaaaggaaatgaatacctgttcagagttagagcagtgaac
aagtatggggaaggagaaactttggaaagtgaggctgtaaaggccacagatccgtttact
gtaccatcagctccaacagatgtggaggtcaccagcgcaaccagtgataccatgactatc
tgctggaagagacctgagactgatggtggcagccgcataagtggttacatcattgagaag
agggagaagcagggagtccgctgggtccgggtcaacaagaaactcgtttatgaccaaaga
gccaaagcctcgtgtctgcgtgaaggttgtgaatatgaattccgagtttttgctgaaaat
tctgctggactgagtgaacccagtcttccatgcccgctcacactggcagaggatcccaaa
tttttaccttcccctccttcaaagctctccataactgattcatctagatcttccatcacc
ctgtcgtggaacaagccgctatttgatggtggagcagcagtcactggatacaaaattgag
tacagaaaatctaccgaagaagagtggaatgttggtgtccacaacacggacaaaacagag
ttcacggttactgggttgtcctctgggacacaatatgtttttactgtcagatccataaac
aaaattggcatcagtgagcccagtcctgaatcagatccacaagtggccatggagagagag
gaggagcccaggtttgatattactgctgacacaaggaagacacttcttgtaaaggctggc
agttcatttaccttaaccatgcctttcactggcaaaccagttcctagtgtaacatgggag
aaagcagatgtagatctcagagtaagaggaatgattaacaccagcagctctgtcacctcc
atcacactggaaggtgcaacccgcgacgactcagggaaatacacagtcaaactgcaaaac
atagctggatctacatgcctgacactcaatgtacgggtcttggattcacctggtccgcct
actcatttaacagtcaaagatgtgacaaaaatctctgccactgtttcttgggacatccca
gaaaatgagggaggagatcctgtcaaaaattatcttgtagatatacatgacatcaggaaa
aaaggctggacaagactcacagataaatgtcggcgactgtcatacaaggtgtctgacctg
gaggaggggggcatctacttcttcagaattacagctgaaaatgagtatgggatcggagta
ccagctgagaccaaagaaggcacgaaaatgacagacacggtagactgggagacaaatctc
ggagcttaa

DBGET integrated database retrieval system