KEGG   Takifugu rubripes (torafugu): 101072512Help
Entry
101072512         CDS       T02386                                 

Gene name
rpa2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru03030  DNA replication
tru03420  Nucleotide excision repair
tru03430  Mismatch repair
tru03440  Homologous recombination
tru03460  Fanconi anemia pathway
Module
tru_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101072512 (rpa2)
   03420 Nucleotide excision repair
    101072512 (rpa2)
   03430 Mismatch repair
    101072512 (rpa2)
   03440 Homologous recombination
    101072512 (rpa2)
   03460 Fanconi anemia pathway
    101072512 (rpa2)
DNA replication proteins [BR:tru03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    101072512 (rpa2)
DNA repair and recombination proteins [BR:tru03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     101072512 (rpa2)
   MMR (mismatch exicision repair)
     101072512 (rpa2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     101072512 (rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 101072512
NCBI-ProteinID: XP_003977145
Position
Un
AA seq 279 aa AA seqDB search
MQFGNMWNQGYNESNMAGGYTQSPGGFASPALSQGGEKKGRSRATQIIPCTVSQLMSASQ
ADEAFKVGDVEVVQITLVGVIRSTDKSMTNIQYKVDDMTAAPMDVKQWVDTEDPNVDSTV
LPPDTYVKVSGNLRSFQNHRSVVAFSVRPLEDMNEITSHMLEVVQAHMILGTPKSMGSGG
GRVNSNSTQMPRTNTETLGGSYTGVDMMANNGLSANQNQVLSLIRSCPYPQGISIQELKQ
RLSGIGLSVIKQVVEFLSNEGHIFSTIDEDHYKSTDNDE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttggcaacatgtggaatcagggttacaatgaatctaatatggccggtggttac
acacaatctccgggaggcttcgcatcacctgcgttatcccagggaggagagaagaaaggg
agatcccgtgctacacagataatcccctgcaccgtgtcgcagctcatgtcagcctcccag
gccgacgaagcctttaaagtaggagatgtagaagttgtccagattacgcttgtgggtgtc
attagaagcacagacaaatctatgaccaacatccagtacaaggtagatgacatgacggct
gctcccatggatgtgaagcaatgggtggacacagaggaccctaatgtggatagcactgtc
ctacctcctgacacatatgtgaaagtttctggcaatcttcgttcatttcaaaaccataga
tctgttgtggcattcagtgtcagacccctagaggacatgaatgaaatcacctcacacatg
ctggaagttgtccaggcacacatgatccttgggacacctaagagcatgggtagcggtgga
ggacgagtgaacagtaactccactcagatgccgcgaacaaacacagaaaccctaggaggg
agctacacaggagtggacatgatggccaacaatggattaagtgcaaaccagaatcaggtg
ctgagtttgatacgaagctgcccatacccccaggggatcagcattcaggaactgaaacag
agactcagtggaataggcctgtcagtcataaaacaagtggtggaattcctaagcaatgaa
ggacacatcttttctacaatcgatgaagaccactacaaatccacagacaatgatgaataa

DBGET integrated database retrieval system