KEGG   Takifugu rubripes (torafugu): 101072544Help
Entry
101072544         CDS       T02386                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase WNK4-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101072544
   01009 Protein phosphatases and associated proteins [BR:tru01009]
    101072544
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101072544
Protein kinases [BR:tru01001]
 Serine/threonine kinases: Other
  Wnk family
   101072544
Protein phosphatases and associated proteins [BR:tru01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101072544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 101072544
NCBI-ProteinID: XP_029692572
Position
5
AA seq 1447 aa AA seqDB search
MLPRAAEQDGEGEEPTVPDPPVHAPELGHHRDPSSESGEEAADVFSRSSGGRLPWQPSKK
EQDRDEEEMQAVASSPDGRFLKFNIEIGRGSFKTVYRGLDTETTVEVAWCELQTFRLNRA
ERRRFNEEVEMLKALQHPNIVRFFDSWKSSVRGHKCTILVTELMTSGTLKTYLRRFRQMK
LKLLQRWSFQILKGLQFLHSRRPPILHRDLKCDNIFITGPSASVKIGDLGLATLKKASFV
KSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCILEMATSEYPYSECRNAAQIYRKVTSGTK
PDSFYKVKVPELKEIIEGCIRTRSCERFTIQDLLDHRFFREQLGVRVDLAEDDDGSKSAL
KLWLRMGHNKKLHGKYKDHNAIEFLFEIYKDVPEEVAQEMVVLGFLSEADYKLVAKAIRH
RVTAIKHHREKQQHLKDGGPDHAPKTTQPARPNPTSSTCAPAAEILTNQATPTAPGTSSV
VSSLSSPMDPGTSDTSRRMEANEDDSVSKARSRAKVSGGADSSSGALDTPETAPSNAVPL
SPAPVAQDSPRPQPAPAPPGTWPPSTGPPLPFLRFPTVGCSIMHAGLLSSNQSSRQSDGS
MNERSITRGQSVWVTPRLPPAEHRGLPARGGPGPGLGLRLLLPRRQVTKVTFRKLRPLCP
HLLLTCSCASDVTSGLSDGTDGPSEKAPRDLSPRAPKQFKRRARSRLRITGVSHLLDRVV
ECQLQTHDNKVVTFKFDLDGDGPDDIASVMVHRDFILPAERGGFIARMNDIIQRAESMMP
QQQPDGALVAEPDSPTASEAATPSSTGLTRTSSSSSLPDIADSDSSQLKAADFYIDSEAT
PPVRPLRSQSFHSSTASGHQTTEPLQLQDSAPPSLLLLPPQAPLTVAPPTNNLPRVLSNP
SLLRQSPGPPPPPAPAPPPAPAPPAPAPPPAPPPPPPPPPPPAPPPPPAPPLTPSGLHQE
PLTRVSSPSLHLPHAPPPQATLSPPLSPSLGSTFDPTSPTSFSGPFSPYPPYSAPIPQTA
PTPSRQEALPHWALGTTQTPSHQRKESSSLPPHGEEVFVLSVVGFCGSAGTLTQFSVSCL
QNLPPPTGPSTPSEASGVKEEDSAPHRVTSSSPPPLSPGPEGKQKDFTVGRFQVTPFKAP
PTDHSHPRPPHQVTPFKAPPTDHSHPRPPHQVTPFKAPPTDHSHPRPPHQVTPFKAPPTD
HSHPRPPHQVMPIPHSPPASSQSESSESSAEEQGQTGGSITSVPSPGHLLGYHDNQRVEQ
QDRREEEAGEGSADGSATNNQFNQWWNRSAPLISSEESDSDLEEMWAELHELRERHLAEV
QNLQANQKQEIEDLYRRMGKVPPPGIVSPAAMLNQRQRRLSKTGNYPPRKNSLQRLDVLP
PAGIMRKSPASSSGSPGRARRGVTFAPKHNSMTEAEEDHEDDEEETSPGSRGSRPVQDLE
DLDQSRV
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccgcgctgctgagcaggacggcgagggggaggagcctacggtcccggaccct
ccggtccacgctccggaactgggccaccatcgggaccccagttcggaatcaggggaagag
gccgctgacgtgttctcccgctccagcgggggccggttaccctggcaaccaagcaaaaag
gagcaggaccgtgatgaggaggagatgcaggcggtggcgtcctcccccgatggacggttc
ctcaaattcaacatcgagattggccgagggtccttcaagacggtctaccgaggcctggac
accgagaccaccgtggaggtggcctggtgtgagctgcagacgtttcggctgaacagggcg
gagcgccggaggttcaacgaggaggtggagatgctgaaagctctgcagcatcccaacatc
gtgcggttcttcgactcctggaagtcgtcagtcaggggtcacaagtgcaccatcctggtg
acagagctcatgacgtctggaaccctgaagacgtacctccgcaggttccgccagatgaag
ctgaagctgctgcagcgttggagtttccagatcctgaaggggctgcagttcctgcactca
cgccgcccccccatcctgcaccgagacctcaagtgcgacaacatcttcatcactgggccg
agtgcgtcggtaaagatcggagacctgggcctggccacgctcaagaaggcctcgttcgtg
aagagcgtcatcggaaccccagagttcatggctccggagatgtacgaggagaagtacgat
gaagccgtggatgtttatgcctttggcatgtgcatcctggagatggcgacgtctgagtac
ccatattccgagtgccggaacgctgctcagatctaccggaaagttaccagcggaaccaaa
ccagacagcttctataaagtgaaggttcctgagctgaaggagatcatcgaaggctgcatc
cggaccaggagctgcgagaggttcaccattcaggatctgctggatcaccggttctttcgg
gagcagctgggggtccgtgtggacctggctgaggacgacgatggctcgaagtcagctctg
aagctctggctccggatgggccacaacaagaagcttcacggcaaatataaagatcacaac
gccatcgagttcctgttcgagatctacaaagacgtccccgaggaggtggcccaggaaatg
gtggtgctcggctttctgagcgaggccgactacaagttggttgccaaggcgatcaggcac
cgagtgacagccataaagcatcatcgggagaaacagcagcacctgaaggacggtgggccc
gaccacgcccccaaaaccacccaacccgcccgtccaaacccaacctcctccacatgtgct
ccagctgctgagatcctgaccaatcaggccacgcccacggcgccgggcacatcgtcagtg
gtgtcgtccctcagcagcccaatggatcctgggaccagcgacacgtccaggaggatggag
gccaatgaagacgacagtgtgtccaaagccaggtcgcgagccaaagtgtccgggggggcg
gacagcagctcaggcgcactggacacgcctgaaactgcgccctcaaacgccgtcccgctc
agccctgctcccgtggcccaggacagcccccgtccccagccggctccagcccctccgggg
acctggcctccgtccacaggtccccccctgcccttcctgcgcttccctacggtcggttgc
tccatcatgcacgccggcctgctgtcgtccaatcagagcagtcggcaaagtgatgggtca
atgaatgaaagatcaataacacggggacagagtgtgtgggtgacgccacgtttgccccct
gcagagcatcgcggtctcccagcgcgcggagggccgggccccggcctcggcctccggctt
ctcctcccccgccgacaggtaacgaaggtaacattcaggaagctccgccctttgtgtcct
caccttctgctgacgtgcagctgcgcctcggacgtgacctccggtctgagcgacggcacc
gacggcccgtcagagaaggccccccgggacctgagccctcgggctcccaagcagttcaag
aggagagcaaggtcccgtctgaggatcacaggggtgtcccacctgctggaccgtgtggtg
gagtgccagctccagactcacgacaacaaggttgtgacattcaagttcgacctggatggc
gacggtccggacgacattgcctccgtgatggtccacagagacttcatcctgccagctgag
cgggggggcttcattgctcgcatgaatgacatcatccagagggcggagtctatgatgccc
caacagcagcccgacggcgctctggtcgcagagccagactcgccgacggcgtcggaggcc
gcaacaccgtcctccacaggtctgaccagaacttcatcttcctcttcacttcctgacatc
gcagattccgactcctcccagctgaaggcagcagatttctacattgactctgaagccacg
ccccccgtgagacccctgaggtctcagtccttccactcctccacagcttcaggccaccag
accacagaacccctccagctccaggactctgcacccccatcgctgctcctcctcccccct
caggctcccctcactgtggcacctcccaccaacaacctgccacgagtcctcagtaaccct
tccctcctcagacaatctccaggccctcctcctcctcctgctcctgctcctcctcctgct
cctgctcctcctgctcctgctcctcctcctgctcctccccctcctcctccccctccccct
cctcctgctcctcccccgcctcctgctcctcccctcactccttcaggcctccaccaggaa
cctctaaccagggtttcctcccccagtctccatctcccacatgcgccccccccccaggct
accctctctccacctctgtctccatctctgggttctacctttgacccaaccagtcccacc
tccttctctgggccattctccccttatccaccctacagtgcccccatacctcagacagcc
cccacccccagcaggcaggaagcgttgccccattgggcactgggcaccacccagaccccc
agtcaccagagaaaggagagctcatcactgcccccccatggtgaggaagtgtttgtgctg
tccgtcgtgggtttctgtggttctgcggggactttgacccagttcagtgtgtcttgttta
cagaacctgccccccccgactggacccagtactcccagtgaagccagtggtgtgaaagaa
gaggattcagctccacacagagtgacctcctccagcccccccccactgtcacctgggccc
gaggggaagcaaaaagacttcactgttggtcggttccaggtgacaccctttaaagccccg
cccactgaccacagccacccacgccctccccatcaggtgacaccctttaaagccccgccc
actgaccacagccacccacgccctccccatcaggtgacaccctttaaagccccgcccact
gaccacagccacccacgccctccccatcaggtgacaccctttaaagccccgcccactgac
cacagccacccacgccctccccatcaggtgatgcccattccccactcgcctccagcttcc
agccaatcagagagctctgagagcagcgccgaggaacaaggccaaacagggggcagcatc
acctctgttccatctcccgggcatcttctgggttaccatgacaaccagagagtggagcag
caggacaggagggaggaagaggcgggggagggctctgctgacggctcggccacaaacaac
cagttcaaccagtggtggaaccgctcagcacctttaattagttctgaggaatccgacagc
gaccttgaggagatgtgggcggagctccacgagctccgtgaaagacacctggcggaggtg
caaaacctgcaggccaatcaaaaacaagagattgaagatctgtaccggaggatggggaaa
gtccctccccctggcatcgtctcccctgctgccatgttgaaccagcgccagcgccgcctc
tccaagacaggaaactaccctcctcgaaaaaacagcctgcaaaggctggatgtgctgccc
cctgcaggcatcatgaggaagagtccagccagcagcagcggatcaccggggcgggcacgg
aggggcgtgacctttgcccctaagcacaactccatgacagaagctgaggaggaccatgaa
gatgatgaggaggagaccagtccagggtctagaggaagtagaccagttcaggatttagag
gacctagaccagtccagggtctag

DBGET integrated database retrieval system