KEGG   Takifugu rubripes (torafugu): 101073653Help
Entry
101073653         CDS       T02386                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00564  Glycerophospholipid metabolism
tru00565  Ether lipid metabolism
tru00590  Arachidonic acid metabolism
tru00591  Linoleic acid metabolism
tru00592  alpha-Linolenic acid metabolism
tru01100  Metabolic pathways
tru04010  MAPK signaling pathway
tru04217  Necroptosis
tru04270  Vascular smooth muscle contraction
tru04370  VEGF signaling pathway
tru04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101073653
   00565 Ether lipid metabolism
    101073653
   00590 Arachidonic acid metabolism
    101073653
   00591 Linoleic acid metabolism
    101073653
   00592 alpha-Linolenic acid metabolism
    101073653
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101073653
   04370 VEGF signaling pathway
    101073653
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101073653
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101073653
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101073653
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101073653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Transposase_22
Motif
Other DBs
NCBI-GeneID: 101073653
NCBI-ProteinID: XP_029691822
Position
5
AA seq 575 aa AA seqDB search
MKKTAASACENVNHHSDSLCPGEQNCVSERKKRIQKSFSRLGLDCTEDSVPHIALLGSGG
GERALVAMLGSIQQLVKEGLFDTLLYIGGISGSTWAMASLYSGEDLRTGVDQIIATMQGP
GVPLDKIVAWLDDRTEETTFSLTDIWAVLISTQIMKQLDLRHLSGDANRSATNPYPIYST
VERECTSDKPENGHWFEISPHESGLTDMDWFIKTAHLGSRFCAGKLVEEKPEMDVLKLQG
ICGSALADGQTIIHHLLRLRGAEFGDIPTQAHLIYVAIDHILNLIKRTTTDPELLAILEK
LQEKLKEIIESGHINLLKTSSLEEGKTVCQENNTLLIEELELCCENLQSVNHSKCYLLWK
LLKLLPPLLKKWEWGNTNNFLYCSHDANIPSPLCSKEIFYLIDAGLWMNVPYPPFLGAKR
DIDLIIAPDFSAGEVFETLTLAKKYALDKGKPFPKIDDQIKKEKDWPKDCYVFEGKEKEP
TIVYMPLFNRANCRDAKELQAKMKKFCTLQFPYNNDMMNELLDIARDNIKRNKTILVQEM
EKAIQRRSRRSSTHIRVEMSLVANVFLKVMDATVI
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaactgctgccagtgcttgtgagaatgtcaatcatcattctgactccctatgt
cctggggaacagaattgtgtttctgaaaggaaaaaaagaattcagaagtcattttcaagg
ctgggtttagactgtactgaggactctgtccctcacatcgctctgttgggctcgggtgga
ggagagagggcactcgtggcaatgttgggctccatccagcaactggtgaaagagggtctg
ttcgacacactgctctacattggaggaatctctgggtcgacatgggccatggcctccctc
tacagcggagaagatcttcggactggtgtggaccaaataattgctacaatgcagggtcct
ggagtcccactggacaagattgtggcctggctggatgacaggacagaggaaacgacattt
tctcttactgacatctgggctgtattaatctccactcaaataatgaaacagctggatctt
cgacatctttcaggggatgccaacagaagtgccaccaacccgtatcccatttactccact
gtagagagggaatgtacatcagacaagcctgaaaacgggcactggtttgaaataagtccc
catgagtctggtttgactgacatggactggttcattaaaacggctcatctggggagcagg
ttctgtgctggaaagctggttgaggagaagccagagatggacgtgctcaaacttcaaggt
atttgtggcagcgcattggcggacgggcagacaatcatccatcacttgctccgtctcaga
ggggctgaatttggagacattcctactcaagcccaccttatttatgtggccattgatcac
attttaaacctgatcaaacgcaccactacggatcctgagcttctggctatcctggagaaa
cttcaggaaaagctaaaagaaatcatagaatctggtcacattaatctgctgaaaacaagt
tctttggaggagggaaaaactgtctgccaggaaaacaacacactgctgatcgaagagctg
gagctttgttgtgaaaatttgcagtctgtaaatcacagcaaatgttaccttttgtggaag
cttttgaagttactcccacctctacttaaaaaatgggaatggggaaataccaacaacttc
ctctactgttcacatgatgccaacattccatctcccctctgttccaaagagatcttctac
ctgatcgatgctgggctgtggatgaacgtaccctaccctccatttcttggagcgaaaaga
gacattgacctcatcatagcaccagacttcagtgctggagaagtatttgagaccctgact
cttgcaaagaaatatgcactggacaaagggaagccttttccaaagatagatgaccaaatc
aagaaggagaaagactggcccaaagattgttacgtgtttgaggggaaggagaaggagcca
accatcgtttacatgccgctcttcaacagagccaactgcagagatgcaaaagaattgcag
gcaaagatgaagaagttctgcaccttgcaatttccctacaacaacgacatgatgaacgag
ttgttggacatcgcgagggacaacatcaagaggaacaagacgatcctggtgcaagagatg
gaaaaggccattcagcgcagaagccgccgcagctccacacatatcagagtagaaatgtca
ctcgtggcaaacgtgtttctaaaagtgatggatgcaactgtgatttaa

DBGET integrated database retrieval system