KEGG   Takifugu rubripes (torafugu): 101073662Help
Entry
101073662         CDS       T02386                                 

Gene name
hadha
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00062  Fatty acid elongation
tru00071  Fatty acid degradation
tru00280  Valine, leucine and isoleucine degradation
tru00310  Lysine degradation
tru00380  Tryptophan metabolism
tru00410  beta-Alanine metabolism
tru00640  Propanoate metabolism
tru00650  Butanoate metabolism
tru01040  Biosynthesis of unsaturated fatty acids
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru01212  Fatty acid metabolism
Module
tru_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tru_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tru_M00085  Fatty acid biosynthesis, elongation, mitochondria
tru_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101073662 (hadha)
   00650 Butanoate metabolism
    101073662 (hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    101073662 (hadha)
   00071 Fatty acid degradation
    101073662 (hadha)
   01040 Biosynthesis of unsaturated fatty acids
    101073662 (hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101073662 (hadha)
   00310 Lysine degradation
    101073662 (hadha)
   00380 Tryptophan metabolism
    101073662 (hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101073662 (hadha)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     101073662 (hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101073662 (hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 Fimbrillin_C
Motif
Other DBs
NCBI-GeneID: 101073662
NCBI-ProteinID: XP_003962300
Position
2
AA seq 764 aa AA seqDB search
MMAGVRALGVLSRFTARRYTLSSGAASRTFSVASSMLARTHVDYEVKGDVAVVRINDPNS
KVNTLSVQMQNELTEIMNEIWANNDVKSAVLISKKPGCFIAGADINMIQACADSEEITKL
SQEGQKMFEKIEKSPKPIVAAINGSCLGGGLEFAIACQYRIATKSKKTVLGTPEVMLGLL
PGAGGTQRLPKMVGLPSAFDMMLTGRNIRADKAKKMGLVNELVDPLGPGLMSPEERTINY
LEEVAIECARGIVNKKIPLRKEKGTMQKIQDYIMSYPVVRNQIYKTVQGKVMKQSKGLYP
APLKIVECVKTGLEQGPTAGYLAESQNFGHLGKTPESAALIGLYHGQVACKKNRFGTPQR
EVKTLAVLGAGLMGAGIAQVTVDKGVSTILKDTTVAGLARGQEQVYKGLNTKTKKKSITS
FERDSILSNLRGQLDYNGFEKADMVIEAVFEDINIKHAVVKEVEAVIPPHCIFATNTSAL
PIKDIAAASKRPDKVVGMHYFSPVDKMQLLEIISTEQTSKDTIASAVAVGLKQGKVIIVV
GDGPGFYTTRCLAPMLAEAVRVLQEGVDPKKLDSLTTSFGFPVGAATLADEVGIDVAAHV
AEDLGKAFGSRFGGGNVEVLKTMVDLGFKGRKSGKGCYVYQPGLKSKEINPEIGEILEKY
RMTPHPTVSSDSDVQYRLVSRFVNEAVLCLQEGILNNPLEGDIGAVFGLGFPPCLGGPFR
FVDTFGADKLVEKMRQYEAVYGNQFTPCQLLLDHAKDSSKKFHK
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgatggctggtgttcgagcccttggtgttctttccaggttcacagcaaggagatataca
ctctcctcaggcgctgcttctcgcaccttctcagtagcttcttcaatgttggcccgaact
catgttgactatgaagtcaagggcgatgttgctgtggtacgaatcaacgaccccaactcc
aaggtcaacacactgtcagtccaaatgcagaatgagttgacagaaataatgaatgaaatc
tgggccaataatgatgttaaaagtgctgtcctcatatctaaaaagccaggatgcttcatt
gcaggagctgacatcaatatgattcaggcctgtgcggattctgaagaaatcaccaaactg
tctcaagaagggcagaagatgttcgagaagattgaaaagtctcccaaacccattgttgct
gccatcaatggctcttgtttaggaggtggcttggagtttgccattgcctgtcagtacaga
attgcaacaaagagtaagaaaacagttctcggtactcctgaagtgatgctggggcttcta
cctggagctggtggtacccaaagactccctaaaatggtgggtctgcccagtgcctttgac
atgatgctgacgggaagaaacatccgagcagataaagccaaaaagatggggctagttaac
gaacttgtagaccctctcggacctgggctaatgagtcctgaggaaagaaccataaactac
cttgaggaagttgccattgagtgcgccagagggattgtcaacaagaagatccctcttcgc
aaggaaaaaggcacaatgcagaaaattcaagactacattatgagctacccagtggtacgg
aatcagatctacaaaaccgtccaaggcaaagttatgaagcagagcaagggactctaccca
gcgcccctgaaaatagttgaatgtgtaaagacgggactagaacaaggccccactgcggga
tacttggctgagtctcagaattttggtcacttgggaaaaaccccagaatccgcagccttg
attggcctttatcacggccaggttgcctgcaagaagaaccgctttggaactcctcagaga
gaagtcaagaccctggccgtcctgggagcaggtttgatgggagcaggtatcgcccaggtg
acggtggacaaaggcgtgagcaccatcctgaaggacaccactgttgctgggctcgccaga
ggacaagagcaagtttacaaaggactgaacaccaagacgaaaaagaagagcatcacatcg
tttgagagggactccatcttgtccaacttgaggggccagctagattacaatggcttcgaa
aaggctgacatggttatcgaagctgtgtttgaagacatcaacattaagcatgcagttgtg
aaggaagtggaggctgtgattccccctcactgcatatttgccaccaacacgtctgctctg
cccattaaggatattgctgccgccagcaagagaccagacaaggtggttggaatgcactac
ttctctccagtggacaagatgcagcttttggagatcataagcactgagcagacatcgaag
gacaccatagcctctgcagtggcagtcggtctgaagcagggcaaagtcatcattgtagtt
ggagatggacctgggttctacacaacaaggtgtctggctcccatgttggctgaagcagtg
agagttcttcaggaaggagtcgaccctaagaaattagattctctcaccacgtcttttggc
ttccctgtgggtgcggccacgcttgctgatgaagtgggtatcgacgtggctgcccacgta
gcggaggacctcggcaaagccttcggatcccgctttggcggtggaaacgtggaggttctg
aagaccatggtggacctgggtttcaagggtcgcaaatctggaaagggttgctacgtttac
cagccaggactcaaatccaaagagatcaacccagaaattggagagatcctggagaaatac
aggatgacgccacatcctactgtgtcgtcggactctgatgtgcagtacagactggtttct
cggttcgtgaatgaggccgtgctgtgcctgcaggaaggcatcctcaataacccgttggaa
ggggacatcggggctgtgtttggcctgggattccccccctgccttggaggtcctttccgc
tttgttgacacattcggtgcagacaagttggtcgagaagatgaggcagtatgaagccgtc
tatgggaaccagttcactccgtgccagctcctactggaccatgctaaggattctagcaag
aagttccacaagtga

DBGET integrated database retrieval system