KEGG   Takifugu rubripes (torafugu): 101073979Help
Entry
101073979         CDS       T02386                                 

Gene name
mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00450  Selenocompound metabolism
tru00970  Aminoacyl-tRNA biosynthesis
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101073979 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101073979 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tru01007]
    101073979 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tru03016]
    101073979 (mars2)
Enzymes [BR:tru01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101073979 (mars2)
Amino acid related enzymes [BR:tru01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101073979 (mars2)
Transfer RNA biogenesis [BR:tru03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101073979 (mars2)
 Prokaryotic type
   Other AARSs
    101073979 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 101073979
NCBI-ProteinID: XP_003970664
Ensembl: ENSTRUG00000012627
UniProt: A0A3F2YPB4
Position
14
AA seq 598 aa AA seqDB search
MGFLCNPVMRTRFLFLTRGCKAVPELHKIVLANAAPVKNPEIRYASTENRNYYITTPIFY
VNASPHLGHLYSAVIADCFHRHKQLQGFNSRFATGTDEHGLKIQQAAEAAGKEPLEFCTT
VSERFRHLFSSCNISNTDYIRTTEQRHHRAVQHFWSVLCSKGLIYKGSYEGWYSTQDESF
LTPSQVTTALDSTGKEIKVSLESGHKVEWMKEENYMFRLSGFRSQLLDWLRENPRAIQPE
RFHHSVLQWLQEELPDLSVSRQKSRLQWGIPVPEDDGQTIYVWLDALVNYLTVVGYPNNH
ERWWNVAHHIIGKDILKFHAIYWPSFLLGAGLPLPQTIHVHSHWTVAGKKMSKSLGNVID
PQERSQLFTTDGLRYFLLRQGVPDTDCDYRDDKVVKLLNAELADALGGLLNRCTATALNP
AQVYASFCPDSFPRERGGRADDDDYRMLESVRHLPAVVEQHFEDMHVYKALEAVSTCVRQ
TNGFVQRHAPWKLDRKDSADQRWLGTIIHVSLECLRIYGTLLQPVVPEISNKLLSRLGVQ
PHERSWTNLNFLPRFEGKDCPFEGRALGSDSGVLFSRLESQRADQQKNRKMEKGSNLK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcctctgtaatccagtcatgaggactcgttttctttttctcaccagaggctgt
aaagctgttcccgaactacacaaaattgtcttggcgaatgcagcgccagtgaaaaatccc
gagatcagatacgcgagcacagaaaacaggaattactacattacgactccaatcttttat
gtcaacgcttctcctcatttaggacacttgtattccgctgtgattgccgactgctttcac
aggcataagcaactgcagggcttcaactccaggtttgctacaggcacagatgaacacggc
ttgaaaatccagcaagcagctgaagctgcaggaaaagaaccgctggaattctgcaccact
gtgtcagagagattcaggcatctcttcagcagctgtaacatatccaacacagactacatc
agaaccaccgagcagagacaccatcgggccgtgcagcacttctggtcggtgctctgcagc
aaagggctcatctacaaagggagttatgaaggctggtattctactcaagatgaaagcttc
ctcacaccatcgcaggtgaccactgccctggactctacagggaaggaaatcaaagtatcg
ctggagagcggtcacaaggtggagtggatgaaagaggagaactatatgttccgtttgtct
ggatttcgatctcagctgcttgactggctcagagaaaatcctcgtgccattcagccagag
cgtttccaccactctgtcctgcagtggctgcaggaggagctccctgatctgtccgtgtcc
cgccagaaaagtcgtctccagtggggaatccccgtcccggaggatgacggacaaaccatc
tacgtgtggctagatgcgctggtgaactacctcacagtagttggatatccaaacaaccac
gagagatggtggaacgtggcccaccacattattggaaaggacatcttaaaatttcacgcc
atctactggccgtcgtttctcctgggggccgggctgcctctgcctcagacgatacacgtg
cactctcactggacggtggcagggaagaagatgtctaagagtttggggaacgtgatagat
ccacaagaacgctcgcagttgttcacaacagatggcctgaggtacttcctcctccgtcag
ggtgtcccagacacggactgcgattacagagacgacaaagttgtaaagctgctcaacgcg
gagctcgcagacgctttgggaggtctgcttaaccgctgcacggccacggcgcttaacccc
gctcaggtctacgcctccttctgccccgactccttcccacgtgagcgcggaggccgagct
gacgatgacgactatcgcatgttggagagtgtgaggcacctccccgctgtggtggagcag
cattttgaggacatgcatgtttacaaagccctggaggctgtcagcacctgcgtgaggcag
accaacggctttgtccagcggcacgcgccgtggaagctggacaggaaggacagtgcagac
cagcgctggcttggcaccattatccacgtttccctcgaatgcctgaggatttacggcacc
ctcctccagccagtagtgccggaaatatctaacaagctgctctccagacttggtgtacaa
ccgcacgagaggagctggacaaatttaaacttcctccccaggtttgagggaaaggactgt
ccctttgaggggagagcactggggtcagactcaggggtgctttttagccgtttggagagt
cagagagctgaccaacagaaaaacaggaagatggaaaaaggcagcaacttgaaatga

DBGET integrated database retrieval system