KEGG   Takifugu rubripes (torafugu): 101074026Help
Entry
101074026         CDS       T02386                                 

Definition
(RefSeq) mitogen-activated protein kinase 13-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04068  FoxO signaling pathway
tru04218  Cellular senescence
tru04261  Adrenergic signaling in cardiomyocytes
tru04370  VEGF signaling pathway
tru04620  Toll-like receptor signaling pathway
tru04621  NOD-like receptor signaling pathway
tru04622  RIG-I-like receptor signaling pathway
tru04625  C-type lectin receptor signaling pathway
tru04912  GnRH signaling pathway
tru04914  Progesterone-mediated oocyte maturation
tru04933  AGE-RAGE signaling pathway in diabetic complications
tru05132  Salmonella infection
Module
tru_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101074026
   04370 VEGF signaling pathway
    101074026
   04068 FoxO signaling pathway
    101074026
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101074026
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    101074026
   04621 NOD-like receptor signaling pathway
    101074026
   04622 RIG-I-like receptor signaling pathway
    101074026
   04625 C-type lectin receptor signaling pathway
    101074026
  Endocrine system
   04912 GnRH signaling pathway
    101074026
   04914 Progesterone-mediated oocyte maturation
    101074026
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101074026
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101074026
  Infectious diseases
   05132 Salmonella infection
    101074026
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101074026
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101074026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 101074026
NCBI-ProteinID: XP_003963019
Position
3
AA seq 363 aa AA seqDB search
MEAHAHFSREEINNTVWEVPEKYTRLKQIGTGAYGSVCSTINEKTKEKVAIKKLHRPFQS
EIFAKRAYRELRLLKHMKHENVIGLLDVFTPALGLDEMQDFYLVMPYMFTDLSKVRGPLS
EDKVQFLIYQTLCGLRYIHKAGIIHRDLKPGNLAVNQDCELKILDFGLARSADAEMTGYV
VTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMIHGKTLFKGKDYMDQLTQIMKVTGVPG
PEFIQKLDSIEAKNYVKALPRYPRKDFSTLFPKASAKGIDLLEKMLVLDGDERLTAELAL
EHSYFDSLRDPDDFPEPTPYDDSHDNATLSLDEWKRLCFREVKSFVPFPRRDSKRKNTLT
MSP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaggcacacgcacatttctctcgggaggaaataaacaacacggtgtgggaagtcccg
gagaaatatacacggctcaaacagatcggtaccggggcgtacggttccgtgtgctcaaca
ataaatgagaagactaaagagaaagtggccattaagaagctccacaggcctttccagtca
gagatatttgcgaagagggcctaccgggagctccggctgctcaaacacatgaagcatgag
aatgtaattggacttcttgatgtgttcacacctgccttgggactcgatgagatgcaggac
ttctaccttgtgatgccttacatgttcactgacctgtcaaaggtgcgaggccccctttct
gaagacaaagtccagtttcttatctaccagacgctctgtggtctcaggtacatccacaag
gctggaataatccaccgggatcttaaacctggaaacttggctgtaaatcaagactgtgaa
ctgaagattctggacttcggcttggcccgcagtgctgatgctgagatgacgggctacgtg
gtgacccgttggtaccgggctcccgaggtcattctgaactggatgcactacacccagact
gtggacatctggtccgtgggatgcatcatggccgaaatgatccacggaaaaaccctcttc
aaagggaaagattacatggaccagctgactcagatcatgaaagtgacaggagttcctggg
ccagagttcatacagaagctggacagcattgaggccaaaaattatgtaaaggcgcttcct
cgctatccaaggaaagatttttcgacgttgttcccaaaggcaagtgcaaagggtattgat
ctgctggaaaaaatgctggttctggatggagacgagaggctgacagctgaacttgctctg
gagcactcctattttgatagcctaagagatcctgacgactttcctgagcctacgccatat
gacgacagccatgacaacgccacgttatccctggatgagtggaagcgattatgtttcaga
gaggtgaaaagctttgtgccattcccacggcgagactcgaagagaaaaaacacccttaca
atgtctccttga

DBGET integrated database retrieval system