KEGG   Takifugu rubripes (torafugu): 101074108Help
Entry
101074108         CDS       T02386                                 

Gene name
lamb2
Definition
(RefSeq) laminin subunit beta 2
  KO
K06243  laminin, beta 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04510  Focal adhesion
tru04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101074108 (lamb2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101074108 (lamb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N APG6 F5_F8_type_C TPR_MLP1_2
Motif
Other DBs
NCBI-GeneID: 101074108
NCBI-ProteinID: XP_003962939
Position
3
AA seq 1780 aa AA seqDB search
MPNSLFLLLCVVAAALGQEPDPSHVCAHGSCYPATGDLLVGREKNLKASSTCGLRRKERY
CIVSHLQDEKKCFDCDSRRPYDPVYNTINHRIENVITTFKPHRKNSWWQSENGKSEVFIQ
LNLDAEFHFTHLIMTFKTFRPAAMLIERSADFGRTWQIYRYFSHDCSSNFPGVSQGPLRK
INDIICESRYSDIEPSTEGELIYKVLDPSITIKDPYSPTIQNLLKITNLRVNFTRLHTLG
DNLLDPRPEIKEKYYYAIYELVVRGNCFCYGHASECAPINGIRDDIDGMVHGRCVCNHNT
KGLNCEQCDDFYNDLPWMPAEGHNTNACRKCNCNGHSNICHFDMAVYLASGNISGGVCDD
CQHNTMGYQCDMCKPFYYKDPAKDIRDPHVCVACDCDPDGSQNGGMCDSHTDTSLGLVGG
QCRCKVNVDGPRCDKCKTGFFGLSADNPQGCQPCQCDRMGTVLGNSQCDPVSGDCFCKRL
VTGRSCDKCLPEHWALSHDLNGCRACDCDVGGALDNLCSKETGQCRCRSHMTGRQCSQVD
SGYFFMALDYFLYEAELAKMGQSCTVETREHQAGRLATWTGVGFARVPEGGTLDFHISNI
PYSMEYDLLIRYESQMPRDWEEVRITVIRPGPIPTSSPCGNTIPDDDRLTVLLPSGTRFM
VPSHPVCLERGVTYTLRFEFTRYQDVNSVLNGAANAILFVDSISLIPRHSSMEMFNAGDP
TANSRKQNYERYRCHDSAKTVSRNLMSNTCSKLISSMSAIIHDGALPCNCDPQGSSSSVC
DVRGGQCHCRPNVIGRRCDQCAWGTYGFGPSGCTACGCSLEGSVTRLCDRYTGQCQCHPG
AFGRYCDACKAGHWGFPTCRPCQCNGHTDECDQRTGACIRCRDNTGGDKCERCADGYYGN
PASGLCHPCPCPDGPNSGRHFAATCYQDIQSRQIICNCNQGYIGARCGGCAPGYHGNPSQ
PSGRCQPCQCNNNIDMTDMAACDRRTGECRKCLYNSEGPTCGICKSGYFGDASQRNCRKC
VCNFLGTDRSQCMDNEDCVCQRATGQCQCLQNVIGLTCDHCAPNHWNLAGGRGCEPCGCD
PNNSVSSSCNEFTGQCQCRSGFGGKTCTDCEENYWGDPRTQCRACDCDPRGIDTTQCNRV
TGHCVCLQGVSGVRCDQCARGFSGHFPNCQPCHQCFGDWDRIVQDLAGRTKALAQRAHEI
QNTGLTGAYEKFFRNLEDKLAQAQGIVNVRNATASAVAILMELIEDLRAQISEATDTLNH
LEGDLTMVQDSNSEASKELSALEREARELNLTSEQLHSQLDILKNSNFLGAFDSILSSYN
RSRDAERCANESVITKSSIVVQSANTRYRTQRLMTLKKDDFNQKNAANKRTLGDFRNRLQ
GLDMKKVNEKICGTPNDAPCGESPCGGAGCRDDDGNPHCGGLNCNGAVAAADNALERGKH
AEKELNKAMREVEGLYIKVVEVKSKAEEAKGKAQAALDKATATKKNIERSNKDLRDLIKQ
IRDFLTQEEADPDSIEVVANRVLELSIPASSLQIKHLADEIKGKVQSLSNVDAILQKTKD
DVRKAEQLLLNAKTVRHHAEKVKATTEAVKEALLNCKTAQASAEKAILTAKVDIMDTETR
LAQIESVTSNSENDLNVAIRHLETLGRDINALKTKCANNSMAAARAEETATMARDKANEA
KQILDGQLTDKYHEVQQRVGTKVKALMDAKKRAESLRNEATNLLKDAQHKLQMLTELEKS
YEENQRKMEGKAHQLDGLEDKMKSILNDINKQIQIYNTCQ
NT seq 5343 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactcgctgtttctgctcctgtgcgttgtggctgctgctcttggccaggagcct
gaccccagtcacgtttgcgcccatggcagctgctacccagcaacaggagatctgcttgtt
ggtcgagagaaaaacctgaaggcctcatccacctgtgggctgaggaggaaagagcgctac
tgcatcgtcagtcatctgcaggatgaaaagaaatgttttgattgcgattcgcgacggcca
tatgatccggtgtataacaccatcaatcatcggatagagaatgtcatcaccacctttaaa
cctcaccgtaaaaactcctggtggcagtctgaaaatggaaagtcggaggtttttatccag
ctgaatctggatgctgagtttcattttactcacttgataatgactttcaagactttccgt
ccagcagctatgctgattgaacgttcagcagatttcggccgaacttggcaaatctaccgt
tacttttcccatgactgttccagtaactttcctggagtgtcccaaggtcctttgcgcaaa
ataaatgatatcatctgtgaatcgcgctactctgatatcgaaccatcaacagagggagag
ttaatttacaaagtcttggatccgtccatcacgattaaagatccttacagcccgaccatc
caaaacctgctaaagatcaccaacttgagggtgaacttcacaaggcttcacacactggga
gacaatttacttgaccccagaccagaaattaaagaaaagtattattatgctatctatgag
ctggttgtgcgtggcaactgcttctgctatggccacgcctctgagtgtgctcccatcaat
ggcatcagagatgatatagatgggatggtccatggcaggtgtgtgtgcaaccataacacc
aagggtttaaactgtgaacaatgtgatgacttctacaatgacttgccctggatgccagct
gaaggacacaatactaatgcctgcaggaagtgtaactgtaatggccactccaacatttgc
cactttgatatggctgtgtatttggcctctggaaatatcagtggaggagtgtgtgacgac
tgccagcacaacaccatgggctaccagtgtgacatgtgcaaaccgttctactataaagac
cctgcgaaggatatcagagaccctcacgtgtgcgtagcctgtgactgtgaccccgatggt
tcccagaacggaggtatgtgcgacagccataccgacacatctctgggcttggtgggtggc
caatgccgctgcaaagttaatgttgatggaccacgctgtgacaagtgtaagacgggcttt
tttggtctaagtgcagacaacccccagggctgccaaccttgtcagtgtgaccgaatggga
actgtgctgggtaattcccagtgtgacccagtcagcggagactgcttctgcaagcgcctt
gtcactggacgcagttgcgacaagtgtttgccagaacactgggcgctgagtcatgatctg
aatggctgcagagcctgtgactgtgatgtcggaggagcattggacaacctttgctcaaag
gagactgggcagtgtcgctgccgcagtcacatgactggacgtcagtgttcacaggtagat
tcaggatatttcttcatggccctggattactttctttacgaggctgagctggccaaaatg
ggccagagctgtacagtggagacgagggagcaccaggcaggtcgtcttgccacgtggaca
ggtgtcgggtttgctcgggtgcccgaaggcggaaccctggactttcacatctctaacatt
ccctactccatggaatatgacctactgatccgctatgagtcacagatgccgcgagactgg
gaagaagtgaggatcacagtgatccggccagggccgattcctaccagcagcccctgtgga
aacaccatcccagatgatgacagactcactgtccttttgccttctggaaccaggtttatg
gtcccctctcacccagtatgtcttgagaggggtgtgacttacacccttcgctttgagttc
acacgctatcaggatgtgaacagcgttctcaacggagcagccaatgctatcctatttgtg
gactctatttccttgataccacgacactccagcatggagatgttcaatgcaggggatcca
acagctaacagcagaaagcagaactatgagcgctatcgctgccatgacagtgcaaagact
gtgagccgcaacctgatgagcaacacctgcagcaagctgatcagcagcatgtccgctatc
atccatgatggggcactgccttgtaactgcgacccacaaggatcgagcagctctgtgtgc
gatgttcgtgggggccagtgtcactgcagacccaacgtgattggccgacgctgtgaccag
tgcgcctggggaacttatggctttggaccgtcaggctgtacagcctgtggctgcagcttg
gaaggatccgtgactcgactttgtgacaggtacacaggccagtgccagtgtcatccagga
gcatttggcaggtattgtgatgcatgcaaggcaggtcactggggtttccctacctgccgt
ccatgccaatgtaatggacacactgatgagtgtgaccagaggaccggagcctgtatcagg
tgcagggacaacactggaggggacaagtgtgaaaggtgtgctgatggctactatggaaat
ccagcttctggactttgccatccatgtccttgtcccgatgggcccaacagtggacgtcac
tttgctgcaacgtgttaccaggacatccaaagcagacaaatcatctgcaactgcaatcag
ggttacataggggctcgatgtgggggatgtgctccaggttaccatggtaacccatctcag
ccttctgggcgctgccaaccatgccagtgcaataataacatcgacatgaccgacatggct
gcttgtgacagacgcactggcgagtgcaggaagtgcctgtacaacagcgaaggccccaca
tgcggcatctgcaagagcggctattttggagatgcttcccaacgcaattgcaggaagtgc
gtttgtaattttttgggtaccgaccgcagccaatgtatggacaacgaggactgtgtgtgc
caacgtgccacagggcaatgccagtgtctacaaaatgtcataggtctgacatgtgaccac
tgtgcccctaaccactggaacctggccggtggcaggggctgtgagccctgtggctgtgat
ccaaacaactcagtctcgtcctcatgtaatgagttcactgggcagtgtcaatgtcgtagt
ggctttggaggaaagacctgcactgactgtgaggaaaactactggggagacccaaggaca
cagtgtagagcctgtgactgtgacccgcggggcatcgacaccacacagtgcaaccgcgtg
accggccactgtgtttgcctgcaaggggtgtcaggtgtccgttgtgaccagtgtgccaga
gggttctctggccattttcccaactgtcaaccctgtcaccaatgtttcggggactgggat
cgcattgtacaggacttagcagggcgtaccaaggctctagcacagcgtgctcatgagatt
cagaacactggactcactggggcctatgagaagtttttcagaaatctagaagacaaatta
gcacaggctcagggcattgtgaatgtgcgcaatgccactgcttcagctgttgctattcta
atggaacttattgaagatcttagagcacaaattagtgaggcaactgacaccctgaaccat
ctggaaggagacctgactatggtccaagacagtaactctgaggcaagcaaagagctgagc
gctctggagagagaggccagagaactcaatctaacatctgaacagctacattcccaactg
gatatcctcaaaaattctaacttccttggtgcgtttgacagcatacttagctcctataac
cggtcgcgtgatgcggagaggtgcgctaatgaatcagtaatcactaagtccagcatagtg
gtccagtccgcaaacactcggtatcgcacccagcggcttatgaccctgaagaaggatgac
ttcaatcaaaagaatgccgcaaacaagcgcacactgggagacttcagaaacagactgcag
ggcctggacatgaagaaagtcaatgaaaaaatttgtggcactccaaatgatgctccctgt
ggggagagtccgtgtggaggtgccggttgccgtgatgatgatggaaaccctcattgtgga
ggcctaaattgtaatggcgccgtagcagcggcagacaatgccttggagagaggaaaacat
gccgagaaggaacttaacaaagccatgcgagaggttgaaggactctatatcaaggtggtg
gaagtcaagagcaaggcagaggaagccaagggcaaagctcaagcagcgctggacaaagcc
actgcaaccaagaaaaacatcgagcgctccaacaaagacctgagagatttgatcaaacaa
atcagggattttctcacccaagaggaggcagatccagacagtattgaagtagtagcaaac
cgtgtgttggagctctccatacctgcctcctcccttcagatcaaacatcttgcagatgaa
atcaagggaaaagtccagagcctttccaacgtggatgctatcttacagaagacaaaggat
gacgtccgcaaggcagaacaactcttactgaatgccaagactgtaaggcatcacgctgag
aaagtgaaggccacaacagaggcggtgaaagaggccttgttgaattgtaagactgcccaa
gcatcagcagaaaaggccattctgacagcaaaagttgacattatggacactgaaacccga
ctagcacaaattgagtcagtgacctcaaacagtgagaacgatctaaatgttgccattcgc
catctggaaacactggggagagacattaatgccctgaagaccaaatgtgccaacaacagc
atggcagcagcgcgagctgaggaaacggccacaatggcacgagacaaggctaacgaagcc
aagcagattctagatgggcagctgacagataagtaccatgaggtacagcagcgagttggt
acaaaggtgaaagcgctaatggatgctaagaagagggcagagagtctcagaaatgaggct
acaaacctgctcaaagacgcccagcataagctccagatgctgacagaactggagaagagc
tatgaggaaaaccagaggaagatggaggggaaagctcatcagctggatggcttggaggac
aagatgaagtccatcctcaatgacatcaacaaacaaatccagatctacaatacatgccag
taa

DBGET integrated database retrieval system