KEGG   Takifugu rubripes (torafugu): 101074584Help
Entry
101074584         CDS       T02386                                 

Definition
(RefSeq) transforming growth factor beta-2 proprotein-like isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04060  Cytokine-cytokine receptor interaction
tru04068  FoxO signaling pathway
tru04110  Cell cycle
tru04218  Cellular senescence
tru04350  TGF-beta signaling pathway
tru04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101074584
   04350 TGF-beta signaling pathway
    101074584
   04068 FoxO signaling pathway
    101074584
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101074584
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101074584
   04218 Cellular senescence
    101074584
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101074584
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tru04052]
    101074584
   00536 Glycosaminoglycan binding proteins [BR:tru00536]
    101074584
Cytokines and growth factors [BR:tru04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   101074584
Glycosaminoglycan binding proteins [BR:tru00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101074584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 101074584
NCBI-ProteinID: XP_003970254
Ensembl: ENSTRUG00000013167
UniProt: H2U981
Position
14
AA seq 420 aa AA seqDB search
MWLPRLALLLLLLRFSGVLLVEGINTCQSINLDKQKSRRIEAVRGQILSKLRIRSPPDED
DEPPPGTVPPEVMLLFNSTRELLKERARLAESACERESSEEDYYAKEVQRIDMLPPRTDT
NVVQSASPNPHYRMVHFDVSGVDLTNSTLVKAEFRIFRAPNPQARASEQRVEIYQVLKPD
EDSTSTQRYIESRTVQLKSKGGWIAVEVTETIKDWVSDSENNLGLKLGVHCPCCTFVPST
NNIVPNKSEELEALFAGVDDERIRQIRKAGKVKGQADFSTKTPHLILTLLPSDRVDNPTT
KNRKKRAAVTDSSTCSRSSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLW
SANNHYNMILPLYNKMNPEASAAPCCVPQDLEPLTIMYFIGRTPRVEQLSNMVVKTCKCR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccgcgcctcgcgctgctgctgctgctgctccgcttctccggcgtcctgctg
gtggagggcatcaacacgtgccagtccatcaacctggataagcagaagtcccggcgcatc
gaggcggtgcgcgggcagatcctcagcaagctccgcatccgcagcccgccggacgaggac
gacgagcccccgcccggcacggtgcccccggaggtcatgctgctcttcaacagcacgagg
gagctgctcaaggagcgcgcgcgtctggcggagtccgcgtgcgagcgcgagagcagcgag
gaggactactatgccaaagaggtgcagaggatcgacatgctgcccccccgcaccgacaca
aatgtggtgcagtcagcgtcccccaacccccactacaggatggttcattttgacgtgagc
ggagtggacctgaccaacagcacgctggtcaaggccgagtttcggatcttcagagccccc
aacccacaggcgcgggcctccgagcagagggtggagatctatcaggtgctgaagcccgat
gaggacagcacctccacgcaacgttatatcgagtcccgcaccgttcagttgaagtcgaag
gggggctggatcgctgtggaggtcacagaaaccattaaggactgggtgtcagattcagag
aataacctgggcctgaagctgggcgtccactgtccctgctgcacgtttgtcccgtccacc
aacaacatcgtccccaacaagagcgaggagctggaggcgctttttgcaggtgtggacgac
gagaggatccggcagattcggaaggcggggaaggttaaaggtcaggcggatttcagcacc
aagacgccgcatctcatcctgaccctgttgcccagtgacagagtggacaacccgaccaca
aagaaccgcaagaagagggccgccgtcacggactcttcaacctgctcccgcagctcagac
cagggttgttgcctgcgctcgctctacatcgacttcagacgtgacctcaactggaaatgg
atccacgagcccaaaggttataaagccaacttctgtgctggcaactgtccgtacctctgg
agcgccaacaaccactataacatgatcctgcccctgtacaacaagatgaaccctgaggcc
tccgctgctccctgctgcgtcccccaggacctggagcccctcaccattatgtacttcata
ggccgcacgccacgcgtcgagcaactttccaacatggtggtcaaaacctgcaagtgccgc
taa

DBGET integrated database retrieval system