KEGG   Takifugu rubripes (torafugu): 101074595Help
Entry
101074595         CDS       T02386                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04218  Cellular senescence
tru04370  VEGF signaling pathway
tru04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101074595
   04370 VEGF signaling pathway
    101074595
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101074595
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101074595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tru01001]
    101074595
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101074595
Protein kinases [BR:tru01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101074595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 101074595
NCBI-ProteinID: XP_003973742
Ensembl: ENSTRUG00000025138
UniProt: A0A3B5KPU1
Position
19
AA seq 389 aa AA seqDB search
MLSNAQNHPLFPNPGGQPNPTGQQNPAGHFLPFHARPGLQIKKNAISDDYKVTSQVLGLG
INGKVLEIFHKKSADKYALKILQDCAKARREVELHWRASPCANIVRIVDVYENLYHSRKC
LLIVMECMDGGELFSRIQDRGDQAFTEREASGIMKNIGEAIQYLHAVNIAHRDVKPENLL
YSSKRQNALLKLTDFGFAKETTTHNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIM
YILLCGYPPFYSNHGLPISPGMKRRIRMGQYEFPYPEWSDVSEEAKQLIRTLLKTEPTQR
MTITEFMNHPWINQSMEVPQTPLHTSRVLKEEKDAWEDVKEEMTSALATIRVDYDQIKIK
TIEDSTNPLLTKRRLKANNTIVNPQPAAH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgctatccaacgcacagaaccacccactgtttcctaacccggggggtcagccgaacccg
accggacaacagaatcccgccgggcactttctcccatttcacgccagacccggcttacag
ataaagaagaatgccatatctgacgactacaaggtgaccagccaggtgctgggactgggc
atcaacgggaaggtgcttgaaatcttccacaagaagagcgccgacaagtatgcattgaag
attttacaggactgtgccaaagcccgccgggaggtagagctccactggagggcatcgcct
tgtgccaacatcgtacgcatcgtcgacgtctatgagaatctctatcatagcaggaagtgt
cttttgattgtgatggagtgtatggacggcggggagcttttcagtcgcatccaagacaga
ggagaccaagcgttcacagaaagagaggcctccggcatcatgaagaatatcggggaggcg
atccaatacttacatgccgtcaacattgcgcacagagacgtcaagccggagaatttattg
tactcctcaaagaggcagaatgccctcctcaagctcaccgactttggcttcgccaaggaa
accactactcataactctctggcgacgccctgctacacgccgtactatgttgctccagaa
gttctcggtccagagaagtacgacaagtcatgtgacatgtggtccttgggcgtaatcatg
tatatcctgttgtgcgggtaccctcccttctactcaaaccacggtttgcccatctcccct
ggaatgaagaggaggatccggatgggccagtatgagttcccctaccctgagtggtccgat
gtgtcagaggaagccaaacagcttatcagaaccctgcttaagacggagccgacacaacgg
atgaccatcacagagttcatgaatcatccctggatcaatcaatcgatggaggtgcctcag
actcccctccacaccagccgggtgctgaaggaagagaaggatgcgtgggaggatgtcaag
gaggagatgaccagtgccttggcgacaattagggtagattatgatcaaatcaagatcaag
accattgaggactcgaccaatccgctgctaacgaaaaggaggctgaaggccaataacacc
attgtgaacccgcagcctgcagcccactga

DBGET integrated database retrieval system