KEGG   Takifugu rubripes (torafugu): 101074957Help
Entry
101074957         CDS       T02386                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent T-type calcium channel subunit alpha-1I-like
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101074957
   04020 Calcium signaling pathway
    101074957
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tru04040]
    101074957
Ion channels [BR:tru04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101074957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel TMEM208_SND2
Motif
Other DBs
NCBI-GeneID: 101074957
NCBI-ProteinID: XP_029706496
Position
17
AA seq 1958 aa AA seqDB search
MTSEEEEGAGIAASTPSRAAAATFEGATATAGGDGEDAAASSSPRRTSTHHLLCPEQKEE
KSKGIEEEEEGRIVHEERIEKEEDEEIVEAEEGDDDDDDDDDDDDGSSNTSMLVVPYPEL
VPVVFFCLKQTTCPRSLCIRMVSNPWFERVSIMVILLNCVTLGMYQPCENIDCSSDRCQI
LQAFDAFIYIFFALEMVVKMVALGIFGRRCYLGDTWNRLDFFIVMAGMVEYSLDLQNINL
TAIRTVRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGL
LRNRCYPEENFTLTTGISLPRPYYMADEDDERPFICSLREDNGIMSCSDIPTRREGGRVC
CLDKEDVLYRQSLGLSPEPMTNGSASVGGLCVNWNQYYTRCHTGHSNPHKEAINFDNIAY
AWIVIFQVITLEGWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETK
QREHQLMQEQRAQCLSSSTLASEPGDCYEELFQLVCHILRKARRQTVILFNTLRGKPRGF
RGVGRGRGGKRRERKANGREGRQRAAMRRHAAPCPHHNKPDHTSPMALTSASVRDGCPQC
ATALSLSDGVGPVCTEKDEADDGAVEETDGEGVSSSNKEKRREGAANHKGCCPRRTCKDI
WYGTRVKLWEIVESKYFNRGIMIAILINTISMGIEHHEQPEELTNVLEICNIVFTSMFSL
EMILKLTAFGSFNYLRNPYNVFDGVIVIISVCEIVGQSDGGLSVLRTFRLLRVLKLVRFM
PALRRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSIKTETGDTVPDRKNFD
SLLWAIVTVFQILTQEDWNVVLYNGMAATSPLAALYFVALMTFGNYVLFNLLVAILVEGF
QAEGDANRSNSDDDRSSSNFDESEKHDSIKLSDPRICTLTPNGHLELGGCSSSRGSYSSE
RRSVTVDSRKSSVMSLGKSSLERRSLSLRHGRSSNYHNWGRPLPPHSGWSRRSSSNSLGR
RSYGFGGAPLVGGSLRVRSSCSPQSYPYSAEQESLLTHPSHSHHPLSKHHPPPPLLLSRH
FARRRDRRALSLELPELLRAGGQPPGHPPFHPDTGRKSGCGAGGSVTGGSGIGSGLGGGH
RDCNGKTPGIHTRLMSEVFPQVNARKDRADLDEETDYSLCFRIQKMIEVYKPDWCETRED
WSVYLFSPQNGFRLLCQSIIAHKLFDYVVLVFIFLNCITVALERPKILQGSVERVFLTIS
NYIFTTIFVAEMTVKVVSMGLYLGXETYLRSSWNILDGFLVFVSLIDIVVSMAGGAKILG
VLRVLRLLRTLRPLRVISRAPGLKLVGETLITSLKPIGNIVLICCAFFIIFVCLPSQLFK
GKFYYCVGFDVKNITNKSDCLAANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYHG
LDAVGIDQQPITNXHPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEVEEAKRR
EEKRQRRMEKKRRKAQKLPYYASYGPARLAIHTLCTSHYLDLVITFIICINVITMSLEHY
SQPRVSGWGVRTLLETALKYCNYVFTSTFVIEASLKLVAFGFRRFFKDRWNQLDLAIVLL
SVMGITLEEIESNASLPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGN
LGLLFMLLFFIYAALGVELFGELVCNADYPCEGMSRHATFENFGMAFLTLFQVSTGDNWN
GIMKDTLRECPPGGSGSDYSCHAGLQFISPLYFVSFVLTAQFVLINVVVAVLMKHLDDSN
KEAQEDAEMDAEIEMELAQGGLCCMMGGIGAIAGATGSAVSGAGAGAAGAVGGPGATSDE
GGGGGAHEGLAQRRCRLFSPALESQWLDSVSLLIKDSLEGDMIDNLSGSVFHHYSSPPVC
KDCRSHPQEQIKLAEVEQASLMSEQLSDKSSSLRCLTT
NT seq 5877 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgaggaggaggagggggccggcattgcagcatcgacaccatcaagagcggca
gcggccaccttcgagggagcaacagcaactgcagggggcgacggcgaggatgctgccgct
tcctcctcccctcggaggacctccactcatcacctcctctgtcctgagcaaaaggaggag
aaaagtaaaggaatagaggaggaggaggaggggaggatcgtgcatgaagagaggattgag
aaggaagaggatgaggagatagtggaggcagaggaaggtgacgacgacgacgatgatgat
gatgatgatgatgatggcagcagtaacaccagtatgctggtggttccctaccctgagctg
gtaccggtggtcttcttctgcctgaaacagacgacctgcccccgcagcttgtgcatccgc
atggtctccaacccgtggtttgagcgcgtcagcatcatggtcatcctgttgaactgcgtg
accctgggaatgtatcagccctgtgagaacatcgactgctcctcagaccgatgtcaaata
ctgcaggcttttgatgcgttcatctacattttcttcgctctggagatggttgtaaagatg
gtggccctgggaatctttggccgcagatgttacctcggggacacgtggaatcgactggac
ttcttcatcgtcatggcagggatggttgaatattcgctggacctgcagaatatcaatttg
acggccatcagaacagtccgagtactacggccgctcaaagcaatcaacagagtgcccagc
atgcgcatcctcgtgaacctgctgctcgacaccctgccaatgctgggcaacgtcctcctc
ctctgcttctttgtcttcttcatctttggcatcattggcgtacagctgtgggcggggctt
ctgaggaaccgctgctacccagaggagaacttcacactgaccacagggattagtctgccc
cggccgtactacatggccgacgaggacgacgagcggcccttcatctgctccctccgtgag
gacaatggcatcatgtcctgctccgacatccccactcgccgcgagggtggccgggtttgt
tgcttggacaaagaggacgtcctttaccgccaatctctgggcctgagcccggagcctatg
accaatgggagcgccagtgtgggagggctgtgtgtcaactggaaccagtactacaccagg
tgtcatactggacacagcaaccctcacaaagaggccatcaactttgacaacattgcctat
gcctggatcgtcatatttcaggtcatcaccctggaggggtgggtggagatcatgtactat
gtaatggacgcacactccttctacaacttcatctacttcattctgctgattattgtgggt
tctttcttcatgattaacctgtgcctcgtggtcatcgccacccagttctcagagaccaag
cagagagagcaccagctgatgcaggagcagcgagcacagtgtttgtcctcctccaccctg
gcgagcgagcccggagactgctacgaggagctcttccagcttgtctgccacatcctgcgc
aaagccaggaggcaaaccgtcattctgttcaacaccctgcggggaaaacctcgcgggttc
cgcggcgtcgggagaggaagaggaggaaaaaggagggagcggaaagccaatggaagagag
ggccgtcagagggctgcaatgaggagacatgctgcaccctgtcctcaccataacaagcct
gaccacacttcacccatggccctcacctccgcctccgtcagagacggctgcccccagtgt
gccacggccctttcgctctccgatggagtcggtccagtttgcaccgaaaaggatgaagcg
gacgatggagccgtggaggagaccgatggggagggggtttcttccagtaacaaagagaag
agacgggagggcgccgcaaaccacaagggctgctgccccaggagaacatgcaaggacatt
tggtacggcacccgggtgaagctgtgggagatcgtggagagcaaatacttcaacagaggc
attatgatcgcaattctcatcaataccatcagcatgggcatagagcaccacgagcagccg
gaggaactcaccaatgtcctggagatctgcaacatcgtcttcaccagcatgttctccttg
gagatgatcctcaaactgacagcctttggctctttcaactacctgaggaacccctataat
gtctttgatggagtgattgtcattataagtgtgtgcgagattgttggccagtccgacgga
ggtctgtctgtgctgaggaccttcaggctgctcagggtcctgaagctggtcaggttcatg
ccggccttgaggagacaactagtggtgctcatgaagaccatggacaatgtggccactttc
tgcatgctgctcatgctcttcatcttcatcttcagcattctcgggatgcacatctttggc
tgtaagttcagtatcaaaacagagacgggggacacggtaccggatcggaagaactttgac
tctctgctctgggccattgttactgttttccagattctgacgcaggaggactggaacgtg
gttctgtacaacggtatggccgccacgtcaccactagctgctctttactttgtggccctc
atgacttttggcaactatgtcctgtttaacttgctggtggcgatcttggtggaaggattt
caggcagagggagatgctaaccgctccaattccgatgacgaccgctcttcttccaacttt
gatgaaagtgagaagcacgactcgataaagctgtctgacccgaggatctgcacactgaca
ccaaatggccatctggagctaggcggctgttctagttccagggggtcctactcttcagag
aggcggagcgtcactgtggactcgaggaagagcagcgtgatgagcctcggcaagagcagc
ctggagagacgctccctttctttacgtcatggccgcagttccaattaccacaactggggg
cgccctctccctccacattcaggatggagtcgcaggtccagctcaaacagtctgggtcgg
aggagttacggctttggaggggctccacttgtaggaggaagtctgcgcgtgcgcagcagc
tgctccccccagtcttacccctattccgcagaacaagagtccctcctcactcatccttcc
cactctcaccatcctctatccaaacatcacccacccccacctctgctgctgtccagacac
tttgctaggaggagggatcgacgggccctttccctggagctcccagagcttctccgcgct
ggaggacaacctccaggtcacccacccttccacccagatactgggaggaagagcgggtgt
ggtgccgggggctctgtcaccggaggctctgggattggaagtggactgggaggggggcac
cgggattgtaatggcaagacgccgggtattcacactcggctgatgtctgaggttttccca
caggtcaacgcgcgtaaagatcgtgcagatctggacgaagaaacagattatagtttgtgc
ttccgcatccagaagatgatagaggtgtacaagcccgactggtgtgagaccagagaggac
tggtccgtctacctgttttccccacaaaacgggttccggctgctctgccagtccataatc
gcccacaagctctttgactacgtggttctggtctttatctttctcaactgcatcacggtg
gccctggagaggccgaagatactccaaggcagtgtagagagggtgtttctcacaatctcc
aactatatcttcaccaccatcttcgtggctgagatgaccgtcaaggtggtgtccatgggt
ctctacctggggnnagaaacctacctcaggagcagctggaacatcctggatggtttcctt
gtcttcgtgtccctcattgatatcgtggtgtccatggcgggcggagcaaaaatcctggga
gtcctccgtgttctcaggctgctcaggacgctgcgccccctcagggtgatcagcagggca
ccaggactgaagcttgtcggggagacactcatcacatccctcaagcccatcggcaacatc
gtcttaatctgctgtgccttcttcatcatctttgtgtgtttgccttcgcagctcttcaaa
gggaagttttactactgcgtgggcttcgacgtgaagaacatcaccaacaagtccgactgt
ctggctgccaattaccgatgggttcatcacaaatacaacttcgacaacctcggacaggct
ctcatgtccctgtttgtactggcctcaaaggacggctgggtcaacataatgtaccacggc
ctggatgctgtgggaattgaccagcagcccatcaccaacnaacacccatggatgctgctc
tattttatctccttcctcctcattgtcagcttctttgtcctcaacatgtttgtgggtgtt
gtggttgagaacttccacaagtgccggcagcatcaggaggtggaggaggccaagagacgg
gaggagaaacgtcagcggcgcatggagaaaaagaggagaaaggcacagaagctgccctac
tatgcctcttacggtccagcccgactggccatccataccctgtgcaccagccactaccta
gacctggtcatcaccttcatcatctgcatcaacgtcatcaccatgtctctggagcactac
agccagccccgggtgagcggatggggagttagaactctcttggagacggcgctcaagtac
tgcaactacgtcttcacctccacctttgtgatcgaggcctcactgaagctcgtggctttc
ggcttccggcgcttcttcaaggacaggtggaaccagttggacctggccattgtgctgctg
tcagtgatgggtataaccctagaagagatagagagcaatgcctccctccccatcaacccc
accatcatcaggataatgagggtactcaggatagcacgagtgctgaagctgctgaaaatg
gccactgggatgagagctctgctggacaccgtggtccaggctctgcctcaggtgggaaat
ctcggtctgctcttcatgctgctctttttcatctacgcagctcttggagtggagctcttt
ggagagctggtgtgtaacgctgactacccctgtgagggaatgagccgccacgccaccttt
gagaactttgggatggctttcctcacactcttccaggtttccactggtgacaactggaat
ggcatcatgaaggacaccctgcgagaatgcccaccgggtggttcagggagtgactacagc
tgccacgcagggctgcagttcatctcccccttgtactttgtgtcttttgtgctgacggcg
cagtttgtcctgatcaacgtcgtggtggcagtgctcatgaaacatctggacgactccaac
aaggaggcgcaggaggatgcagagatggatgccgagatcgagatggagctggcacagggg
ggcctctgttgcatgatggggggcatcggtgccatcgctggggcgacaggcagtgctgtg
agtggggccggcgctggtgcagccggggcagtcggaggtccgggcgcgacatcagatgaa
ggaggaggtggtggagctcacgagggactcgcgcagcgtcgatgtcgactcttctctcca
gctctggagagccagtggttggacagtgtgtccctgttaattaaggactccttggaaggg
gacatgattgacaacctctctggttccgttttccatcactacagttctcctcctgtctgc
aaggactgcaggagccacccacaggagcagattaaactggcggaggtggagcaggcatcc
ctcatgtcggagcagctgtccgacaagtcgtcctctctgcgctgcctgacgacctga

DBGET integrated database retrieval system