KEGG   Takifugu rubripes (torafugu): 101075271Help
Entry
101075271         CDS       T02386                                 

Gene name
sucla2
Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00020  Citrate cycle (TCA cycle)
tru00640  Propanoate metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
Module
tru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101075271 (sucla2)
   00640 Propanoate metabolism
    101075271 (sucla2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101075271 (sucla2)
Enzymes [BR:tru01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101075271 (sucla2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101075271 (sucla2)
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101075271 (sucla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-GeneID: 101075271
NCBI-ProteinID: XP_029701490
Ensembl: ENSTRUG00000014063
Position
1
AA seq 476 aa AA seqDB search
MRGEPPPRADMRMRGEPPPRADMAASLICGRLSASLRNSGTRNTLNSTSKVLAASWMGGQ
QQRRNLSLHEYMSIGLLSEVGISVPVGKVASSSDEAYAVAKQIGSKDLVVKAQVLAGGRG
KGTFEGGLKGGVRIVYSPEEARDISSQMIGRKLYTKQTGEAGRICNQVFICERRYPRREY
YFAITMERSYQGPVLIGSSQGGVNIEDVAAENPDAIVKEPIDIVEGIKMEQAVRVAEKMG
FPPLLVNEAAENMVKLYELFIKYDASMVEINPMVEDSSGMVMCMDAKINFDSNAEYRQKK
VFDLRDWSQEDPRDQQAAKADLNYIGLDGTIGCLVNGAGLAMATMDIIKLHGGTPANFLD
VGGGATAHQVTEAFKLITSDKKVQAILVNIFGGIMRCDVIAQGIIMAVRDLDLKIPIVVR
LQGTRVDDAKALIAASPLKILACDDLDEAAKMVVKLSEIVSLAKQAQVDITFQLPI
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgagcctcctcccagagcagacatgcgcatgcgcggtgagcctcctcccaga
gcagacatggcggcgtccctgatctgcggccgactgtcggctagcctgagaaactcgggg
accagaaacaccctgaattctacttcaaaggttctggctgcttcttggatggggggccag
cagcagaggaggaacctttcgctgcatgagtacatgagcatcgggctgctgagcgaggtg
ggcatctctgtgccggttgggaaggtggccagctcctctgacgaggcgtatgctgtggcc
aagcagatcggttcgaaggacttggtggtcaaagcccaggtcctggctggaggcagaggg
aaggggacgtttgagggcggcctgaagggcggcgtcaggattgtctactcgcctgaagaa
gccagggacatcagctctcagatgattggtcgaaagctctacaccaaacagactggagag
gcaggtcgcatctgtaaccaggtgttcatctgtgagcgcaggtacccacgcagagagtac
tacttcgctatcacaatggagagatcctaccagggtcctgttctgatcggtagctcacag
gggggggtgaacatcgaagatgtcgcagcagagaatccagacgccatcgtgaaggagccc
atcgacatcgtggagggcatcaagatggagcaggctgttagggttgctgagaagatggga
ttccctccattgttggtgaatgaagcagcagagaacatggtgaagctctacgagctgttc
atcaagtatgatgcttccatggtggaaatcaatcccatggtggaggactcgtctggcatg
gtcatgtgcatggatgcgaagatcaacttcgactccaacgcagagtaccgtcagaagaag
gtgttcgacctgcgcgactggagccaggaggacccccgggaccagcaggccgccaaggct
gacctcaactatatcggactggatggaaccatcggctgtctggtcaacggcgctggactg
gccatggccaccatggacatcatcaagctgcacggcggcacgcccgccaacttcctggat
gtggggggcggagctacagctcatcaagtgactgaagccttcaaactcatcacgtctgac
aagaaggttcaggccatcctggtcaacatctttggaggcatcatgaggtgtgatgtcatc
gcccaggggatcatcatggctgtgagagacctggacctgaagatccccattgtggtccgg
ttgcaagggacccgagtggacgacgccaaagctctgatcgctgccagccccctgaagatc
ctggcctgtgatgatctggatgaagctgccaagatggttgtgaagctctctgaaatagtg
tcgctggccaaacaagcccaggtggatataaccttccagctgcccatctaa

DBGET integrated database retrieval system