KEGG   Takifugu rubripes (torafugu): 101075813Help
Entry
101075813         CDS       T02386                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru03040  Spliceosome
tru04010  MAPK signaling pathway
tru04141  Protein processing in endoplasmic reticulum
tru04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tru00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    101075813
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101075813
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101075813
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101075813
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tru01009]
    101075813
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tru03041]
    101075813
   03009 Ribosome biogenesis [BR:tru03009]
    101075813
   03110 Chaperones and folding catalysts [BR:tru03110]
    101075813
   04131 Membrane trafficking [BR:tru04131]
    101075813
   03051 Proteasome [BR:tru03051]
    101075813
   03029 Mitochondrial biogenesis [BR:tru03029]
    101075813
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    101075813
Protein phosphatases and associated proteins [BR:tru01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101075813
Spliceosome [BR:tru03041]
 Complex B
  Other components
   Prp19 complex
    101075813
 Complex C
   Prp19-CDC5 complex
    101075813
Ribosome biogenesis [BR:tru03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    101075813
Chaperones and folding catalysts [BR:tru03110]
 Heat shock proteins
  HSP70 / DNAK
   101075813
Membrane trafficking [BR:tru04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    101075813
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    101075813
Proteasome [BR:tru03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    101075813
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    101075813
Exosome [BR:tru04147]
 Exosomal proteins
  Proteins found in most exosomes
   101075813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 101075813
NCBI-ProteinID: XP_003966054
Ensembl: ENSTRUG00000019608
UniProt: A0A3B5KIU0
Position
7
AA seq 651 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPGNTVFDAKRLIGRKFDDAVVQSDMKHWPFKVVNDSSKPKMEVEYKGEIKTFYPEEIS
SMVLTKMKEISEAYLGKIVNNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGSERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKFKKDISNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSVTRA
RFEELNADLFRGTLDPVEKALRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAADKSTGKENKITITNDKGRLSKEDIEKMVHEAEQFKAEDDAQRDKVTAKN
SLESLAFNMKSTVEDEKLQDKISPEDKKTIIDKCNEVIAWLDRNQTAEKDEYEHQQKELE
KVCNPIITKLYQGAGGMPGGMPGGMPGGMPGGMPGGAGGSSSTGPTIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggaccggcagtaggcatcgatctgggcaccacctattcctgcgtgggcatc
ttccagcatggtaaagtggaaatcattgccaatgaccagggaaacaggaccactcccagc
tatgtggcattcacggacactgagaggctgattggtgatgctgccaagaaccaggtggcc
atgaacccaggaaacacagtgtttgatgccaagcgtctgatcggtcgtaagtttgatgac
gccgtggtgcagtcggacatgaagcactggccttttaaagttgtcaacgattcatccaaa
cccaagatggaagttgagtacaagggtgagataaagaccttctaccctgaggagatttcc
tctatggtcctcaccaagatgaaggagatatctgaggcctatctcggaaagattgtgaac
aatgctgtcatcacagttcctgcttacttcaatgactcccagcgccaagccaccaaagat
gctgggaccatcgctgggctcaatgtgctgcgcatcatcaacgaacccacagccgcagcc
atcgcttatggcctggacaaaaaggttggcagcgagcgaaatgtacttatctttgacctc
ggagggggaacttttgatgtctccatcttgaccattgaggacggcatctttgaggtcaag
tccacagccggcgacactcacttgggcggtgaagactttgacaatcgtatggtgaaccac
ttcattgccgagtttaagcgcaagttcaagaaggatatcagcaacaacaagcgtgcggtg
cgccgcctgcgcacggcctgcgagcgtgccaagcgcaccctctccagcagcacccaagcc
agcatagagatcgactcgctctacgaaggaacggatttctatacctccgtcaccagggcc
cgttttgaagagctgaacgcagatctgtttcgtggaaccctcgaccctgtggaaaaagcc
ctgagggatgccaaaatggacaagtctcagatccatgacatcgtcttggttggcggctca
acacgcatccccaagattcagaagctgctgcaggatttcttcaatggccgtgatctgaac
aagagcatcaaccccgatgaggctgtggcctatggtgcagctgtccaggcggctattttg
gccggagataagtccgaaaatgttcaggacctgctcctgctggatgtcacgcccttgtcc
ctgggaattgagactgctggaggagtgatgactgtccttatcaaaagaaacaccaccatt
cccaccaagcaaacacagatatttaccacttattcggacaaccaacctggagtgctcatt
caggtttatgaaggtgaaagagccatgaccaaggacaataatatcttgggcaagtttgag
cttactgggattccacctgcacccagaggcgtcccccagattgaggtgacctttgacatt
gatgccaatggcattcttaatgtgtctgcagccgacaaaagcacaggaaaagagaacaag
atcaccatcactaacgacaaaggacgactgagcaaggaagacattgaaaaaatggtccat
gaggcagagcagttcaaggctgaggatgatgcccagagagacaaggtgacagccaagaac
tccctggagtctctggcctttaacatgaagagcaccgtggaggatgagaagctccaggac
aagatcagccccgaggacaaaaaaaccatcatcgacaagtgcaacgaagtcatcgcctgg
ctggacaggaaccagaccgctgaaaaggacgagtatgaacaccagcagaaggaactggaa
aaggtgtgcaatcccatcatcaccaagctgtatcagggtgctgggggaatgccaggtgga
atgccaggtggaatgccaggtggaatgccaggtggaatgcccggtggtgctggaggaagc
tcctccactggtccaaccatcgaggaggtcgactaa

DBGET integrated database retrieval system