KEGG   Takifugu rubripes (torafugu): 101076461Help
Entry
101076461         CDS       T02386                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial-like
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00071  Fatty acid degradation
tru01212  Fatty acid metabolism
tru03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101076461
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101076461
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101076461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 101076461
NCBI-ProteinID: XP_003978452
Ensembl: ENSTRUG00000016665
UniProt: H2V092
Position
20
AA seq 668 aa AA seqDB search
MTILSMAFWQCAASKRILGNPCFLRIAALAFKTRTYSSRNASLGEYLHQSVVPTTHYQKS
LPRLPIPRLEDTIRRYLAAQRPLLDDVKFRQTEKISHSFLNGVGRDLHEELVAKDKYEKH
TSYIAGPFLEKYLCSRDSLVTANAFIIFTSDRKKEYNNQLVRATNIVCSAARFLKTLRTG
LLEPEVFHLSPRKSDSNCFKKFIRWVPSSLSWYGASMMNAYPLDMSQYARLFNTTRIPRL
RQDELFTDENGRHVLVMRKGNMYVFDIVDRDGNLVKPAEIHANLKYILDDSTTEPTFPLG
FLTTENRDVWANLRNKLIAAGNAEELHIVDSALFCLCLDDETLTDITHITQNVLSGGGCN
RWYDKSFSIILTKNGESGVNFEHSWGDGVSVLRFVNEIHKDTTEQPLVHPGSATAAVDPD
SVVRRLQFKLDTEMEDAITKARKNSGVLASNLSVHVTDFKRGGRKFFKEKKVSPDAIMQL
AFQMGFLRQYGQTVATTESCSTAAFRHGRLEDIWPVTLPTKTCSHAFVCQPGQHSVEHLN
AMLSECSKYHKQLINEAATGQGFGCHLYVLRHLAMSKGQTLPCLYTDPSYAKVNHIILSS
TTLSSGVLRTGGAAPVVSDGFGLGYGFRDSESRTIVTSYPTLNSHEFQQCVHKSLTDIFN
VLEGKPIS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgactattctgtcaatggcgttctggcagtgcgctgcatcaaagaggatattgggtaat
ccttgttttttaaggattgctgcgctggcctttaagacacggacatacagcagtagaaat
gcttctttgggggagtatttacatcaaagtgtcgtaccaacgacgcattaccagaagagt
ctacccaggctcccgatacccagattggaagataccattaggagatatttagctgctcag
agacctctgttggatgatgtcaaattcagacaaacagaaaaaatttcacacagtttcctg
aatggtgttgggagagatctgcatgaggaacttgtggcaaaagacaaatatgaaaagcac
acaagctacatcgcaggaccttttttggaaaagtatctttgttcaagggattccttagtg
actgccaatgccttcataatcttcacttctgaccgaaagaaagaatacaacaaccagctt
gtccgggcgaccaatatagtttgctctgctgcacgctttctgaaaacattgcgaacaggg
ctccttgagccagaagttttccaccttagccccagaaagagtgattcaaactgctttaaa
aaatttatccgctgggtcccatcctccttgtcttggtatggcgcttctatgatgaatgcc
taccccctggatatgtctcagtatgctcgcctcttcaataccacccggattcccaggctt
aggcaagatgagctcttcactgatgagaatgggaggcacgtcctggttatgaggaaagga
aacatgtatgtgtttgatattgtggacagggatgggaatttggtgaaacctgcagagatc
catgcgaatttgaaatacatattagatgattcaaccacagaacccacattccctcttggg
tttctgaccacggaaaacagagacgtgtgggcaaacctcaggaataagctaatcgctgct
ggaaatgcagaggaattacacattgttgacagtgcgcttttttgcctgtgtttggatgat
gaaactctgacagacatcactcacatcacacagaatgtattaagtggtggtggctgcaac
aggtggtacgataaatccttcagcataattctgaccaaaaatggcgaaagtggtgtcaat
tttgaacactcctggggtgacggtgtcagtgttcttcggtttgtaaatgagatccataaa
gacacgacagaacagccgttggtacacccaggttcggctactgctgctgtggatccagac
tctgttgtgcggaggttgcagttcaagctggacactgaaatggaggacgctatcacaaag
gccagaaagaactctggtgtacttgcatcaaacctcagtgttcatgtcactgactttaag
agaggaggaagaaaattcttcaaagaaaagaaagtgagtccagatgctatcatgcaactg
gcctttcagatgggcttcttgaggcaatatggtcagacagtggcaacaactgagtcctgt
agcacagccgcattcaggcatggccgtttggaggacatatggccagttacacttcctaca
aaaacatgctcacatgccttcgtttgccagccaggccagcacagcgtggagcacttaaat
gccatgctcagtgaatgctcgaaatatcataagcagctaataaacgaagcagcaactggt
caaggatttggctgtcacctatatgttctgcgacacctggcgatgtcaaaaggccagacc
cttccatgcctgtatacagacccatcttatgctaaagtaaaccacatcattctgtcctcc
accacactcagcagtggtgtattaagaactggcggtgctgcccccgtagtctctgatggg
tttggccttggatacggttttagagactctgaaagtcgtaccattgtgaccagctatcca
actctaaatagccatgaatttcagcagtgtgtccacaagtctttaacagatattttcaat
gtcctggaaggaaagccgatcagctaa

DBGET integrated database retrieval system