KEGG   Takifugu rubripes (torafugu): 101077157
Entry
101077157         CDS       T02386                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tru03021]
    101077157 (aff3)
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     101077157 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 101077157
NCBI-ProteinID: XP_011606764
Position
1
AA seq 1141 aa
MTQSWPTQKAFGGNQTLFPNDAKLPSTHQKQSLQLRMSRHPRLAPQKSMLADDLKLSSDD
DDTPRVTYEPAPWNGQSLSAQRARTHGRRVRHSSSDSTGSDCSIESSSSSLQSRSPSQSP
EVHSDPLSPANVQLPCTNTKKTEFPRAAQWQLDKWLQHPQKISVSREEDGSQGVSGNHHS
PYNQPAPSPARSWDSNQEYSPSQTPIPSPQLHYNHINSPLPSPGYSYCPSPSPFPSTCPS
PSSSSQDSPVPSPDLSICPSPHGIPRTSRSPSPITREPPLSPCLSPPSPLTVHHYREVHN
QTQPLPAITPHRPCPAVQPKTVKSSQPAKSSHLPSVDHRSSKSKTTENQDQRKCRTFVTL
DSKDTHSHKSRAKSSFPPGKIQHSEPPKAKHKTHSEQSESRRSSHNSNHKTASLFQRSSQ
HSPKRVKNLAPVPCEPNSGPSSHSNSTSTAVPNSKTGVNSKSNTSQKLQAKATAPPVHAN
PAKTPQKKSQAKQQEEHRGEHQNIPERRKQEKKQDRQREKPAGKPRRREDRRLAEEQLRR
RPWIQSSAEEDEEGQEEDVVVIERPSNKVEKGRRSDKQHRSEWKAAHNKQLHNLPDQSQQ
QERADKGRSERSRHPSLQLSRSLTSQKPSSSSSASSSSDSESEYQATVPKVPAESTSHKR
LSRSRLQGSADGPKEARPRGSSLVKTSEGQGNEGKQKLYTLVPFGRGDQAPAFSQRGLRN
LVVQIDLCLLKRVPESPASSPVKKAPSSSSSSSTNNSQREMKHALVPETGTRDGKRKRKL
ENPGESHRESKKSVPTANELSSRSKPERSFVMETTHNGLLEEYLDSKRLLSPVSPLSDSP
ETTKPPSKTKTSEHNSVHAQLKPKLEVECIKVPRHYQPPSESWGPAGHRGTMPNHDIPHH
AEYYLHEAKRMKHRADAMVDKLGKAVNYIDAALSFMECGKAMEEGPLEAKSPYTMYSETV
ELIRYAMRLKSHSGPGARQEDKQLAVLCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKS
PPKVPLTQPCGKDSGKGADGTPSSLSSKHFRQGSHRSNVSPLISIPHRIHQMAANHLNIT
NSVLYSYEYWEVADNLAKENKEFFNYLNTLSGPLTLHSSIPHVVQYTRQALQWIRISAKL
N
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgactcagtcctggccgacccagaaagcattcgggggcaaccagaccctctttcccaat
gatgccaaactcccaagtactcaccaaaagcaaagtcttcagctgcgaatgtcccgccac
cctcgcctggcaccccagaagtcgatgcttgctgatgacctgaagttgagcagcgatgat
gatgacactccaagggtgacttacgagccggctccctggaatggccaaagcttgtcagca
cagcgcgcgcgcacacatggcaggcgggtgagacattccagctcggactctacgggctca
gactgctccattgagtccagcagcagtagccttcagtcccggagccccagccagagtcca
gaggttcactcggatcctctgtcgcctgccaacgtgcagcttccctgcaccaacaccaag
aagactgagttcccccgtgctgcccagtggcaactggataaatggctacaacacccacag
aaaatatctgtcagccgtgaggaggacggttcccagggagtttcaggaaaccatcattct
ccttacaaccagcctgcaccctctccagccaggtcctgggacagcaatcaggaatacagc
ccgagccaaactcctatcccaagcccacagttacattacaaccacatcaacagtccccta
cccagccctggttacagctactgccccagccccagtccattccccagtacctgcccaagt
cccagctctagctctcaggacagcccagttcccagtcctgatttgagcatttgtcccagt
ccccatggaatcccaagaaccagtcggagccctagccccattaccagagaacccccacta
agcccctgtctcagtccaccttcccctttaacagtccatcactaccgtgaagttcacaac
caaacacaacctctcccagcaataactccccacaggccatgtcctgccgtgcaaccaaag
actgtcaaatccagccagcctgcaaaaagtagtcatcttccctcagttgatcaccgtagt
tccaagagtaaaaccacagagaaccaggaccaaaggaaatgcaggactttcgtcacttta
gactccaaagatactcacagccacaaatccagagcaaagtctagctttcctccaggcaag
atccagcactcagagccccccaaagccaaacacaaaacacactctgaacaaagtgagagt
cgcagatccagtcacaactccaaccacaagacagcatctttgtttcagcggagctcacaa
cacagccccaagagagtaaagaacttagctcctgttccatgcgaaccaaactctggtcct
agttcccattccaattctacttctacagctgttcctaattccaaaactggggtgaattcc
aaatcaaatacaagtcaaaaactacaagcgaaggctacagcacctcctgtgcacgcaaac
cctgcaaaaacaccacagaagaagtcccaggcaaagcaacaggaggagcacagaggagag
catcagaacattcctgagaggagaaaacaggagaaaaaacaagacagacaaagggaaaaa
ccagcaggcaaaccaaggaggagggaggacaggaggctggcggaggagcagctacggaga
cgaccgtggatccagagttcagcagaggaagacgaggagggccaggaggaagacgtggtg
gtgatagagaggccgagtaacaaagtagagaaaggtagaaggagtgacaagcaacatagg
agcgaatggaaagcggcccacaacaaacagctgcacaacctgccagaccagtcacagcaa
caggagagggcagacaaggggaggagtgagaggtcgagacacccttcgcttcagctgtcc
cgttccctcacttctcagaaaccgtcctcctcatcttccgcatcttcaagttcagattcg
gaatcagaataccaggctacagtccctaaagttccagccgaatccacctctcataagagg
ctctctagaagtcgactgcaaggctcagctgacgggccaaaggaggcccgtcccagagga
tccagtttggttaaaacaagcgagggtcaaggtaacgaggggaaacaaaaactctacacc
ctggtcccgtttgggcgaggtgaccaggcacccgcattttcccagcgaggtctcaggaat
ctggtggtgcagatagacctctgtcttctaaaaagagttccagagagccctgcaagctcc
cctgtgaagaaggccccctcttcctccagttcttcttcaaccaacaacagccagcgagag
atgaagcacgcactggtcccggagacgggaaccagagacggcaagaggaaacgcaagctg
gagaatcctggtgaatcacacagagaaagcaagaagagtgttcctacagcaaacgagctg
tcaagccgcagcaaacctgagcgcagctttgtcatggaaaccacacacaacggattattg
gaggagtacctggacagtaagaggctgttgtctcctgtgtcccctctgtctgacagccct
gagaccaccaagcctccatctaaaaccaagacttcagaacacaattctgttcacgctcag
ttaaagcccaagctggaggtggaatgcataaaagtgccaagacattaccaaccaccgtct
gagtcctggggccctgctggacacagaggaaccatgccaaaccatgacatcccccatcat
gctgagtattacctacacgaagctaagaggatgaagcaccgcgcagatgcgatggtggac
aagctggggaaggctgtgaattacatagatgctgctctgtccttcatggaatgtgggaaa
gcaatggaggaaggaccgctggaggccaagtctccttacaccatgtactcggagacagtg
gagcttatcagatatgccatgaggctgaaaagccactctgggcctggggcgaggcaggaa
gacaaacagctggcagttctgtgtttccgatgcctcgccctcctttactggcaaatgttt
cgattaaagaaggaccatgcgctgaaatactccaaagtattgttagactactttaagagt
ccccctaaagtgcctttgacacaaccctgtggtaaagactcaggaaagggtgcagatgga
accccttcttctctttcatccaaacacttccggcaaggttcacacaggagcaacgtgtcc
cctctcattagcattccccatcgcatccaccagatggcagcaaatcacctgaacatcacc
aacagcgtcctctacagctatgagtactgggaggtggcagacaaccttgccaaagagaac
aaagagtttttcaactacttgaacactttgtctggaccgctgacccttcacagtagcata
cctcacgtagtccagtacaccagacaggctctccagtggattcgcatcagtgccaaactt
aactga

DBGET integrated database retrieval system