KEGG   Takifugu rubripes (torafugu): 101077289
Entry
101077289         CDS       T02386                                 

Gene name
foxf2
Definition
(RefSeq) forkhead box protein F2
  KO
K09399  forkhead box protein F
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    101077289 (foxf2)
Transcription factors [BR:tru03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    101077289 (foxf2)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 101077289
NCBI-ProteinID: XP_003974476
Ensembl: ENSTRUG00000007367
UniProt: H2T0M4
Position
20
AA seq 382 aa
MTTETPQQQLDPPPPLRSSPASGVLHPAMLSPQAATESSSSAIKGKKTSSGLRRPEKPPY
SYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPK
GLGRPGKGHYWTIDPGSEFMFEEGSFRRRPRGFRRKCQALKPMYRMMNGIGFGTSILPQS
FDFQAPSATLACHGNSYNLDMMSNSMAGGYDGLSGGHHVPHMSPSPGSTYMASCPVPPSG
EYGPDSSSSPVPSSPAMASALDGHSPYATTSAHWASSGGSPYIKQQPLASSSPASSGLHS
GMSAYSLEQSYLHQNGRDSHSSDISVGIPRYQSHSSVCDRKDFVLNFNGISSFHPSAGGS
YYHHHHHHHPQSVCQDIKPCVM
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgacgaccgagacccctcagcagcagctggaccctccgcctcctctgagatccagcccg
gcgtccggcgttctgcacccagccatgctgagtccacaagccgccacggaaagttcgtcg
agcgccattaaaggaaagaagacaagctcgggtttgcggcgaccggaaaagcctccttac
tcctacatcgctctcatcgtaatggcaatacagagctccccaaccaagagactgacgctc
agcgagatctaccagttcctccaggcgcgcttcccattcttcaggggttcatatcagggc
tggaagaactcagttcgacataatctttccttgaacgagtgcttcatcaagctgcccaag
gggctgggcaggccggggaagggccattactggaccattgatccgggcagtgagttcatg
ttcgaggaaggctcctttcgccgcagaccaagaggcttcaggagaaaatgtcaagcgctc
aagcccatgtaccggatgatgaacggcataggattcggcacctccatcctgccgcagagt
tttgactttcaggctccgtccgccaccctggcctgtcacggcaacagctacaacttggac
atgatgagcaactccatggccgggggctacgacgggctaagcggtggccaccacgtaccc
cacatgtctccgagtcctggctccacgtacatggcgagttgtccggtgccgcccagcggg
gagtacggaccggacagcagcagcagccccgtcccgtcctcccccgccatggcgagcgcg
ctggacggccactctccgtacgccactacttccgcacactgggcatcctccggcgggtcc
ccatacatcaaacagcagcctctggcctccagcagccccgcatcctctggtttacactct
ggcatgtccgcatactccctggagcagagttatctccaccagaacggcagggacagtcac
agcagcgacatctcagtgggcatcccgcgctatcagagccactcctcggtgtgcgacagg
aaagacttcgtgctcaactttaacggcatctcgtccttccacccgtcggcgggcggctcc
tactaccaccaccaccaccaccaccacccgcagagcgtgtgccaggacatcaaaccctgc
gtgatgtga

DBGET integrated database retrieval system