KEGG   Takifugu rubripes (torafugu): 101077743Help
Entry
101077743         CDS       T02386                                 

Gene name
acacb
Definition
(RefSeq) acetyl-CoA carboxylase beta
  KO
K01946  acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00061  Fatty acid biosynthesis
tru00620  Pyruvate metabolism
tru00640  Propanoate metabolism
tru01100  Metabolic pathways
tru04910  Insulin signaling pathway
tru04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    101077743 (acacb)
   00640 Propanoate metabolism
    101077743 (acacb)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    101077743 (acacb)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    101077743 (acacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101077743 (acacb)
   04920 Adipocytokine signaling pathway
    101077743 (acacb)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     101077743 (acacb)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     101077743 (acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     101077743 (acacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp Dala_Dala_lig_C ATP-grasp_3 GxGYxYP_N ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 101077743
NCBI-ProteinID: XP_011614064
Position
21
AA seq 2415 aa AA seqDB search
MLPLALLGLILWILYLFWRINTKSLMMPVEEDKSDGFPPSAKVSSTAQSPPPGEHSPSTV
PSTSEQREGPGPQIGTTSGDLEVKTVDTEALQVPSAARTSNTRMTSSGPEMRERLKFILG
ASEDNSSDDEPMADKPPSGAPQPLTNALSPQQTTCTQAQSRSSSIKPSMSGLHLVKKGRE
HRKMDLQRDFTVASPAEFVTRFGGTRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERT
IRFVVMVSPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWG
HASENPKLPELLNKAGISFLGPSSKAMWALGDKVASSIVAQTAGIPTLPWSGSGLRVDWV
EEDQTQGIMISVPSEIYSKGCVQDVDEGLAGAEEIGYPVVIKASEGGGGKGIRKVESSED
FPGFFRQVQTEVPGSPIFIMQLAQHARHLEVQILADEYGNAISLFGRDCSIQRRHQKIIE
EAPATIAAPSTFEQMERFAVRLAKMVGYVSAGTVEYLFSEDGRFHFLELNPRLQVEHPCT
EMVADVNLPAAQLQIAMGIPLYRIKDLRLLYGEAPWGDSIINFDSPDCMPSPRGHVIAAR
ITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGATGGLHEFADSQFGHCFSWGENREE
AISNMVVAMKELSIRGDFRTTVEYLIKLLETESFRNNDIDTGWLDHLIAEKVQAERPDTM
LGIVCGALHVADASFRKSMSDFLHSLERGQVLPAASLLNSVNVDLIYDGVKYCLKVARQS
PTTYVIIMNGSDIEIDVHRLSDGGLLLSYDGSSHTTYMKEEVDSYRITVGNKTCIFEKEK
DPTVLRSPSAGKLLQYLVEDGTHICAGETYAEIEVMKMVMTLNVQQSGCVHFVKRPGAVL
KSGCILARMELDDPSSVLRVKLNTAVLPPQQPLPIIGEKLHQVFHSVLENLVKVMDGYCL
EEPYFSNKLKQWVATLMKTLRDPSLPLLELQEIMTSVAGRIPPSVEKDIRKVMAQYASNI
TSVLCQFPSQKIANILDYHAATLQRKADREVFFMNTQSIVQLVQRYRSGIRGYMKSVVLD
VLKRYLQVETQFQQAHYDKCVINLREQYKPDMSPVLEYIFSHAQVSKKNILVTLLIDQLC
GRDPTLADELMAILNELTQLSKMENSKVALRARQVLIASHLPSYELRHNQVESIFLSAID
MYGHQFCPENLKKLILSETSIFDVLPNFFYHINQVVCMAALEVYVRRAYIAYELNSIQHH
RLQDGTCAVDFQFMLPSSHPNRGSSRTLNRIPVPVSGPGQFEMRRQSSELFLDGALSPPC
QRMGAMVAFQCFDDFKRNFDEVLSSFAEPLLESASFSDSCSGLYDKENFKNKRENPIHII
NVSIKTADTEDDDALVTALTAFAQSKKAVLFEYGIRRVTFLIAQKREFPKFFTFRARDAF
QEDRIYRNLEPALAFQLELNRMKNFDLTAVPCENHKMHLYLGAARVQQGAEVTDYRFFIR
AIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFSNTSVRTDCNHIFLNFVPTVIMD
PSKIEQSVRSMVMRYGSRLWKLRVLQAELKINIRLTPTGKAIPVRLFLTNESGYYLDISI
YEEVTNTSSGQIMFHSYGNKQGPLHGMLINAPYVTKDLLQAKRFQAQTLGTTYVYDFPEM
FRQALFKLWGPGNGHPKDVLMCTELVLDPQGCLVQMNRLPGDNDVGMVAFRMKMKTPEYP
EGRDIIVICNDITHMIGSFGPQEDELFLKASALARAEGIPRIYIAANSGARIGLAEEIKH
MFQVAWIDPRDPYKGFKYLYLTPQDYTRISSTNAVHCQHVEEDGESRYIITDVIGKDDGL
GVENLRGSGTIAGESSQAYEEIITISMVTCRAIGIGAYLVRLGQRVIQVENSHIILTGAG
ALNKVLGREVYTSNNQLGGIQIMHNNGVTHTTVPDDFEGVFTILQWLSYMPKNKQCPVPV
IPTTDPVDREIEFIPTKAPYDPRWMLAGRPHPTVRGAWQSGFFDHGSFMEIMSSWAQTVV
VGRARLGGIPLGVIAVETRTVELTVPADPANLDSESRVLQQAGQVWFPDSAFKTSQAISD
FSHEHLPLMVFANWRGFSGGMKDMYDQILKFGAYIVDALRTFRQPVLVYIPPHAELRGGS
WVVIDPTINPLCMELYADRESRGGVLEAEGTVEIKYRRKDLLKTMRRLDSVYAGLAEQLA
SPDLPDKECRELESKLKAREEFLLPIYHQVAVQFVELHDTPGRMQEKGVITDILDWKNVR
SFFYWRLRRLLLEEVVKCEILQANKDLSDGHVQSMLRRWFVETEGTVKAYLWDNNQAVVE
WLEKHMSKEDGAPSAIRENMKYLKRENTLKLIRSLVQENPDITMDCIIHMSQNITPSQRA
KLLHLLTTMDNTSNS
NT seq 7248 nt NT seq  +upstreamnt  +downstreamnt
atgctccctttagcactattaggacttatcctatggatattatacttattctggaggatt
aacaccaaatcattgatgatgcctgtggaagaagacaaatctgatggttttccaccttca
gccaaggtctcatccactgcacagtctccacctccaggtgaacattccccgtcgactgtt
ccttctacctcagaacagagggagggtcccgggcctcagatcgggactacgtctggggat
cttgaagtcaaaactgtagatactgaggctctgcaggtgccttctgcggccagaacttca
aacacacgcatgacgagttcaggacctgagatgagggaacgcctcaagttcatcctggga
gcatcagaggacaactcttcagacgacgaacccatggctgacaaaccccccagtggtgcg
cctcagcctctgaccaacgcactctctccccagcagaccacctgtacacaggcacagtcc
cgctcctccagcattaagcccagcatgtctggtctccacttggtgaagaaaggacgtgaa
cacagaaaaatggacctccagagggacttcaccgtggcctcccctgctgagtttgtcacc
cgattcgggggtacccgtgtcattgagaaagtactaatagccaacaatggcatagctgcg
gtcaaatgcatgcgctccatccgtcgctgggcctacgagatgttccgcaatgaaaggacc
atccgatttgtagtcatggtctcccctgaagacctgaaagccaacgcagaatacatcaaa
atggctgaccattatgttcctgtacccgggggacccaacaataacaactatgctaacgta
gagctgatagtggacattgctaagagaatccctgtgcaggccgtgtgggctggatggggc
cacgcatcagaaaaccccaaactgcctgaactgctgaacaaagcagggatttcgttctta
gggccgtccagtaaagccatgtgggctctgggggacaaggtagcttcctctattgtggct
cagactgccggcattcccactctaccgtggagtggatcagggctgagggtggactgggtc
gaggaggaccagacacagggcatcatgatcagtgttccttcagagatctactccaaaggc
tgtgtgcaggatgtcgacgagggcttggcaggagctgaggaaattggctatccagtggtc
atcaaggcttccgaaggaggaggtggaaagggcatccggaaagtagaatcttcggaggat
ttcccaggtttctttagacaggttcagacagaggttcctggctcacctatcttcatcatg
cagctggctcagcacgcgagacaccttgaggttcagattcttgctgatgaatatggaaac
gccatctctctgttcgggcgagactgctccatccagagaaggcaccagaagatcattgag
gaggctcctgctaccatagcagctccgtccacctttgaacagatggaaaggtttgctgtg
cgactagctaagatggtgggctacgtgagtgcaggtactgtggaatacctcttctctgaa
gatggaaggttccatttcctggagctgaatcctcgtctgcaggtggaacatccctgtact
gaaatggtcgctgatgtaaaccttccagccgcccaacttcagattgcaatgggcatcccc
ctttatagaatcaaggacctccgcttgctttatggagaagcaccttggggtgacagcatc
attaactttgacagtccagactgtatgccaagcccgagaggacatgtcatagctgctcgg
atcaccagtgagaacccagatgagggcttcaaacccagttcaggcaccgtccaagagctg
aacttccgcagcagtaaaaacgtgtggggttatttcagcgtgggagcaactggtggactt
cacgagtttgcggactcgcagtttggacactgtttctcctggggcgaaaaccgtgaagag
gccatttcgaacatggtggtggcaatgaaggaactgtccatcagaggggactttaggacc
acggttgagtacctcattaaattactggagacggaaagcttcaggaacaacgacatcgat
accggctggctggatcacctcatcgcagagaaagtgcaggcggagagaccagacaccatg
ctgggtattgtctgtggggctttacatgttgctgatgccagcttcaggaagagcatgtcc
gacttcctgcactcactggaacgagggcaagttctacctgctgccagcctcctcaactct
gtcaatgttgatcttatatatgatggtgtcaagtactgcctcaaggtagctcgtcagtcc
ccaacaacatacgtcatcattatgaatggctccgacatcgagatagacgtccacaggctg
agcgatggcggtcttctcctgtcctatgatggcagcagtcacaccacctacatgaaagag
gaggtggacagctaccgcatcactgtcggcaacaagacttgcatatttgagaaggagaaa
gaccccacggtgctgaggtctccctctgctggcaaactgctgcagtatttggtggaagat
ggaacccacatctgtgcaggagagacctatgcagagattgaggtgatgaagatggtgatg
acactgaacgtgcagcagtctggatgtgtccactttgtcaaaagacctggagctgttctc
aagtctggctgtatcttggcccgtatggagctggatgatcccagcagtgtccttagagtg
aaactcaacacagctgtgctgccaccccagcaaccgttgcccatcatcggggaaaagttg
caccaggtttttcacagtgtgttggaaaatttggttaaagtcatggatggatactgcctg
gaagaaccgtacttcagcaacaagctcaaacagtgggtggccaccctgatgaagacatta
agggacccctcgctgccactgttggaactccaggagatcatgacgagtgtggccggtcgg
atccctcccagcgtggaaaaagacattcgtaaagtcatggctcagtatgccagcaacata
acctctgtcctctgccagttcccgagccaaaagattgcaaatattctggactatcatgca
gcaaccctgcagaggaaggcagacagggaggtgttcttcatgaacacccagagtattgtt
cagcttgtgcagaggtaccgcagtggaatccgcgggtacatgaagtctgtggtgctggat
gtgctgaaacgatatcttcaagttgagacacaattccagcaagctcactatgacaaatgt
gtgatcaacctgagagagcagtacaagcctgacatgagtccggtcctggagtacatcttc
tcccatgcccaggtgtccaagaagaacatcttagtcacactgctcatagaccaactgtgt
ggtagagatccgaccctagcagacgagctgatggctatactgaatgaactcacacagctc
agtaagatggagaactcaaaggtggccttaagagccagacaggtgctgatcgcttcccat
ttaccatcctacgagctgaggcacaatcaggtggaatccatcttcctgtccgccatcgac
atgtacggacaccagttttgtccagagaacttgaagaaactaattctgtcggaaacctcc
atttttgatgttttgcccaacttcttctatcacatcaatcaagtggtctgcatggctgcc
ttggaggtgtacgtgcggcgagcttacatcgcgtatgagctgaacagcattcagcaccac
cggctccaagacggaacgtgcgctgtagatttccagttcatgcttccatcgtcacatcca
aacagagggagcagccgtactctgaacaggattcctgtcccggtcagtgggccaggccag
tttgaaatgaggcggcagagcagcgagcttttcctggatggagctctgtcaccaccgtgc
cagcgcatgggagccatggtggctttccagtgtttcgatgacttcaaaaggaattttgac
gaggtcctctccagctttgcggaaccgctgttggagagtgcgtccttctccgactcgtgt
tctggtctctacgataaggagaacttcaagaacaaaagggagaacccgatccacatcatt
aacgtgtccataaaaacagcagacacggaggatgacgacgccttggttacagcgttaact
gccttcgcccagtcaaagaaagctgtcctctttgagtatggaatcagaagagtaacattt
ttaattgcacaaaagagagagtttcccaagttcttcacattccgagctagagatgcgttt
caggaagaccgcatttatcgtaacctggagccagctttagcctttcagttggagttaaac
cgcatgaagaactttgacttgacggccgttccctgtgaaaaccacaagatgcacctctac
ctcggtgcagcccgcgtgcagcagggggctgaggtcacggactaccgtttctttatacgt
gccattattcgacactcggatctcatcacaaaggaagcctcctttgagtaccttcaaaat
gagggcgaacgtcttcttttggaggccatggatgagttggaggtggcctttagcaacaca
agtgtccgcacagactgcaaccacatcttcctcaactttgtgccaactgtcattatggac
ccttctaaaatcgagcagtcggttcgctccatggtgatgcgctacggcagccgtctctgg
aagctccgggtcctgcaggccgaactgaagatcaacatccgtctgacaccaaccgggaag
gccattccagtccggctctttctcactaatgagtcgggctattacttggacatcagcatc
tatgaggaggtcaccaacaccagttcaggccagatcatgttccactcctatggaaataag
cagggccctctgcatggcatgctgatcaacgccccctatgtgaccaaagacctgctgcag
gccaaacgcttccaggctcaaactctaggcactacatatgtctatgatttccctgagatg
ttcagacaggcactgtttaagctgtggggtccagggaacggacaccctaaagatgttttg
atgtgcactgagctggtcctggaccctcaaggttgtctggtgcagatgaaccgcctgcca
ggagataacgatgtaggaatggttgccttcagaatgaagatgaagaccccggagtaccca
gagggccgggacatcattgttatctgtaatgacatcactcacatgattggctcatttgga
cctcaagaggatgaacttttcctcaaggcttcggcgttagctcgagccgaggggattccc
cgtatttacatagctgctaacagcggcgctcgcattggcctagctgaggagatcaaacac
atgttccaggtggcctggatcgatcccagggatccctacaagggtttcaagtacctttac
ctcacaccacaagactacacacgcatcagctcaaccaacgctgtgcactgtcaacatgta
gaggaagatggagagtccaggtacatcatcactgatgttatcgggaaggacgacggtctc
ggggttgagaacctgcgaggttctggaaccattgctggagagtcgtctcaggcctatgag
gagatcatcacaattagcatggttacgtgtcgagctattggaattggagcctatctggtc
cgactgggacagagagtgattcaggtggagaactctcacattatcttgactggagcaggt
gcccttaacaaggttttgggccgagaagtttatacttccaacaaccagttgggagggatc
caaatcatgcacaataatggagtcacacacaccacagtgccagatgactttgagggcgtc
ttcaccatcctccagtggctctcctacatgccgaagaacaagcagtgccctgttcccgtt
ataccgaccacagatcccgtggacagagagatagaatttattcctacaaaagctccatat
gacccccgctggatgctggcagggagacctcaccccacggtaagaggcgcctggcaaagc
ggtttctttgatcacggctctttcatggagatcatgagctcctgggctcagacagtggtg
gtaggcagagcacggttaggaggaattcctcttggtgtgattgctgttgaaacacgcaca
gttgagttaacagtgccagcagatccagcaaacctggattcagaatctagagtcctgcag
caggccggtcaggtgtggttcccagattcagcctttaaaacctctcaggccatttctgac
ttcagccatgagcatctgcccctgatggtttttgccaactggaggggcttttctggtgga
atgaaagatatgtatgaccagatattaaagtttggggcctacatcgtggatgcccttcgc
actttccgtcagccggtgctggtttacatccccccgcatgcagaactgagaggaggttcc
tgggtcgtgattgatcccactattaaccctctgtgtatggagctctatgccgacagggag
agcagaggtggtgtgctggaggctgaaggaacggtggagatcaaatacaggagaaaggat
ctactgaagactatgagaaggctcgactcagtctatgctggtcttgctgaacagcttgct
tccccagatctgcctgacaaagagtgcagagagctggagtccaagttgaaagcacgggag
gagttcctgttgccaatctaccaccaggtggcagtgcagtttgtcgagcttcacgacact
ccaggcaggatgcaggagaagggcgtcatcactgatattttggattggaagaatgtgcgg
tccttcttctactggcgtctccgtcgcctcctgttggaggaggtggtgaagtgtgagatc
ctgcaggcaaacaaggacctcagtgatggacacgtgcagtccatgctgcgccgctggttt
gttgagaccgagggaacagttaaggcctacctctgggataataaccaagcagtagttgag
tggctcgagaagcatatgtccaaagaggatggtgctccttctgcaatccgagagaacatg
aagtatctgaaaagagaaaacactttgaagctaatccgcagcctcgtgcaggagaatcct
gacataaccatggactgcatcatacatatgagccagaacatcactccatcccagagggcc
aagctcttgcaccttctcacaactatggacaacaccagcaacagttaa

DBGET integrated database retrieval system