KEGG   Takifugu rubripes (torafugu): 101078054Help
Entry
101078054         CDS       T02386                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101078054
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tru04040]
    101078054
Ion channels [BR:tru04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   101078054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 101078054
NCBI-ProteinID: XP_029704229
Ensembl: ENSTRUG00000000702
Position
15
AA seq 942 aa AA seqDB search
MRLPSVFLLLMLLGLCSGTSFPSNINIGGLFPTGSHEYEVFRFALSQHQDVPKLVPQVDM
VDTASSFSMTYAFCSQFSKGVYAIMGLYDRKTVNMLMSFCGSLHVCFITPSFPVQTNNQF
VLQLRPQIQEPLMALLDHFSWTRFVYMYSTDSGLAVLQKILDTAAERNWQVTSVNLDSLT
ETTFIKLLIDLDYKDEFQIIIDCEMERLNSIINLIAAQRRNLKNYHYILANLGFMDLNLT
EFQKLKPNVTGFQLVNWSNPSTEKINQDWLEFDNKDLKLARRRLRYTGALTFDGVSVMAA
AFHNLRQQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRLDGLTGRVQFDERGHRT
NYTVTVMELSLKGPRKIGYWNERRGYVHTAIYRPSMEEFQPIQNRTYVITTILEAPYMML
KKNHEQLEGNDRYEGYCAELASEIAKHVGFNYKLELVGDGKYGARDSETKMWNGMVGELV
YGKADVAVAPLTITLVREQVIDFTKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMC
IVFAYIGVSVVLFLVSRFSPYEWKAEDSDEDETLPSSTSQRAFPSSELPHSAGFSQGQNH
NQQKEKDSPEHTNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSY
TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDGGSTKEFFRRSKIAVFEKMWSYMRG
ADPSVFVKSTSEGVSRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGSNLDSKGYGVAT
PKLSPLRNPVNLAVLKLNEQGLLDKLKNRWWYDKGECGIGGGDSKDKTSALSLSNVAGVF
YILIGGLGLAMLVALVEFCYKSRIESRRMKELIDAAMLSTSLGGMVAGGGAAAVGYGGGV
GGSLGIGGENGRVVTHDFPKAGPQGFPCMSKAASLGLSSTGM
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcccctcagtcttcctcctcctgatgctacttgggctctgcagcggcacaagt
ttcccaagtaacatcaacatcggaggccttttccccaccggctcccatgagtacgaggtc
tttcgtttcgctctgtcccaacaccaagatgttcccaaacttgtaccacaggtggacatg
gtggacacggccagcagcttctccatgacctacgcattctgttctcagttctcaaagggc
gtgtacgccatcatgggtctgtatgatcgcaagacggtcaacatgctcatgtccttctgc
ggctccctccacgtctgcttcatcaccccatcctttcctgttcagaccaacaaccagttt
gttctgcagctgcggccccaaatccaggagcccctcatggccctgctggatcacttctcc
tggaccaggtttgtctacatgtacagcaccgactcagggttggcggtactgcagaagatc
ttggacacagcagcagaacgaaactggcaggttacctccgttaatctggacagtctgact
gagaccaccttcatcaagctgctgattgacctggattacaaggatgaatttcagatcatc
attgactgtgagatggaacggctcaactccatcatcaacctgattgctgctcagaggagg
aacttgaagaattaccattacattctggctaatctgggttttatggacctcaacctgaca
gagtttcagaagctcaagccaaatgtgacaggcttccagctggtgaactggtccaatcca
tcaacggagaagatcaaccaggactggctggagtttgacaataaagatctgaaactggcc
cgcaggaggctccggtacacaggagctctgacctttgatggagtcagtgtcatggcggcg
gctttccacaacctacgtcaacaacgaatcgatatctctcgccgaggcaacgcaggggag
tgcctggccaacccacctgctccctggggccagggcattgacatacagagagcactgcag
caggtgcgtttggatggactgacgggccgcgtccagtttgacgagcgaggacatcggacc
aactacactgtgacggtgatggaactcagcctcaaggggcccaggaagattggctactgg
aatgagagaaggggctatgtgcacactgccatctacaggccgtcaatggaggagttccaa
cccatccagaacaggacatatgttatcactactatactggaagctccctacatgatgctg
aagaagaaccatgagcagcttgaagggaacgacaggtacgaagggtactgcgctgaactg
gcctcggagatcgccaaacatgtgggcttcaactacaagctcgagctggttggggatgga
aagtacggagccagagactctgaaaccaagatgtggaacggcatggtgggcgaactggtg
tacgggaaagccgacgtggcggtcgccccgctcaccatcactctggtgcgagaacaggtg
atcgacttcaccaaacctttcatgtctctgggaatctccatcatgatcaaaaagcccacc
aagtccaaaccgggtgtcttttcttttctggaccctctggcctacgagatctggatgtgc
attgtgtttgcctacatcggggtcagcgtggtgctcttcttggtcagtcgttttagtcct
tatgaatggaaggctgaagattctgatgaagatgaaactcttccttcttctacctctcaa
cgtgcttttccgtcctctgagctgcctcattctgcagggttctcccagggccaaaaccac
aaccagcagaaagaaaaagattctccagaacacaccaatgactttgggatctttaactca
ctctggttctcactgggggcgttcatgcagcagggctgtgacatctccccgaggtctctg
tcagggaggatcgtcggtggggtttggtggtttttcaccctcatcatcatctcctcatat
accgccaacctggcagccttcctcactgtggagaggatggtctcccccatcgagagtgcg
gaggacctggccaagcagacggagatcgcctatggtaccctggatggaggttccaccaaa
gagtttttcagacgatcaaagatagctgttttcgagaagatgtggtcatatatgcggggt
gcagatccatccgtatttgtgaagagcacctcagagggcgtgagcagagttcgaaaatca
aaaggcaaatacgcctacctgctcgagtccaccatgaatgagtacatcgagcagaggaaa
ccctgtgacaccatgaaggtcggaagcaacctggactctaaaggctatggagtggccaca
cccaaactatcccccctcagaaaccccgttaacttggcagtattaaaactgaacgagcag
ggcctgttggacaaattgaaaaacagatggtggtatgacaagggagagtgcggcatcggg
ggaggggactccaaggacaagacgagcgcactcagtctgagcaacgtggcgggggtgttc
tacatcctgatcggtgggctggggctcgccatgctggtagctttggtggagttctgctac
aagtcacgcattgagtcaaggagaatgaaggagctcattgatgctgccatgctgagcacc
agcctcggtgggatggtggctggaggaggggcggcggcggttggttatggaggaggcgtg
ggaggatctttggggatcggaggggagaatggccgcgtggtgacgcacgatttcccaaaa
gctggacctcaaggttttccctgcatgagcaaagctgccagcctgggtctgtcctccaca
ggcatgtga

DBGET integrated database retrieval system