KEGG   Takifugu rubripes (torafugu): 101079585Help
Entry
101079585         CDS       T02386                                 

Gene name
cacng3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit isoform X1
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04260  Cardiac muscle contraction
tru04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101079585 (cacng3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101079585 (cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    101079585 (cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tru04040]
    101079585 (cacng3)
Ion channels [BR:tru04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101079585 (cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 101079585
NCBI-ProteinID: XP_003964565
Ensembl: ENSTRUG00000010025
UniProt: H2TKL7
Position
5
AA seq 316 aa AA seqDB search
MKMLMCDRGIQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSSGDNDTSRKNEEVM
THSGLWRTCCLEGTFRGVCKKIDHFPEDADYEADAAEYLLRAVRASSIFPIMSVGLLFLG
GLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWS
FYFGALSFIMAEMVGVLAVHMFIEKHRKLRAKSRTELIKKSAFSRIPSYRYRFRRRSSVR
SSEAPSRDASPLGKGGYTGPAASEMPLYTLNPREPGNATKPGMGMGGLLNSERDFLQSST
LTKDYNKDPNRRTTPV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctgatgtgtgaccgcggcatccagatgctcgtgacgacggtgggcgcgttc
gccgcctttagcctcatgacaatcgccgtgggcacggactactggctgtactcgcgcggg
gtctgccgcgtgaagagcagcggcgacaacgacacgagccgcaagaacgaggaggtgatg
acgcactccggcctctggcgaacctgctgtctggaagggacatttagaggtgtatgtaag
aagattgaccacttcccagaagatgctgactatgaggcagatgctgcagaatatcttctc
cgtgctgttcgtgcctccagtatcttccccatcatgagtgtggggctgcttttcctgggg
gggctctgtgtagctgccagtgagttttaccggagcagacacaacgtcatcctcagtgcg
ggaatcttcttcgtctcggcagggctcagtaacatcataggaattattgtctacatctca
gccaactccggtgacccgggccaaagtgacagcaaaaagtcctactcctacggctggtcc
ttctacttcggcgctctctccttcatcatggcagaaatggtgggtgtactggccgttcac
atgttcatcgagaagcaccgcaagttacgcgccaagtcccgcaccgagctgattaagaaa
tccgccttcagccgcataccctcttatcgctaccgcttccgccgtcgctccagcgtgcga
tcctccgaggctcccagccgagacgcctcaccactggggaaaggcggctacacaggaccc
gccgcctccgagatgccattgtacaccctgaaccctcgtgagccaggcaacgccaccaaa
cctggcatgggcatgggtgggctgctcaactccgagagggattttctgcagagcagcacc
ctcactaaagactacaacaaagaccccaaccgcagaaccacgcctgtctga

DBGET integrated database retrieval system