KEGG   Takifugu rubripes (torafugu): 101079714
Entry
101079714         CDS       T02386                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tru01002]
    101079714
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101079714
Peptidases and inhibitors [BR:tru01002]
 Metallo peptidases
  Family M1
   101079714
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Peptidase_M9_N
Other DBs
NCBI-GeneID: 101079714
NCBI-ProteinID: XP_011617963
Ensembl: ENSTRUG00000005077
Position
21
AA seq 940 aa
MLDSPPLLLLLLLFASPSGAQPPNPEQHKEVLISSSGQPFPWNHMRLPKTVSPLHYDLGI
HPNLTTLDFTGVVRIQLQVHEDTGVIVLHAKQMQITEALLLAPEGVRPLRVLEYPPFHQL
ALLSDTLLTRGRTYEVLLGFAATLSDSFHGFYRSSYHTSSGAVRVLASTQFEATFARAAF
PCFDEPAFKAKFTIRIIREPRHIAVSNMPTVKTVALPGGLLEDHFDTTVKMSTYLVAYIV
SDFLSVSRTTQRGVKISVYAVPEKIDQTAFALDTAVRLLDFYEDYFDIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRETALLYDPDKSSPSDKLAITKVIAHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEFISVNVTNPELHVDDFFLGKCFEAMEVDSLPSSHPVSTHVENPMQIQE
IFDDVSYDKGACILNMLRDFVTPEAFEIGIIRYLRRFSYQNTVSRHLWESLTDLCSPDLL
DQGDRKHTEFCSARNRPSGASKWYSGDELDVQAIMDTWTLQEGFPLVTVEVRGREVRLSQ
ERYLKTDEPSLTDGFLWQIPLTYVTSASSTIRRFLLKTKTDVLYLPQEVDWVKFNVDMSG
YYMVHYEGDGWNAIINLLQHNHTVLTSNDRASLVHDVFQLVSVGKVRLDTALELSLYLSR
ETETMAVTQGFQELVPLYKLMEKRDMAALENRMKSYIVDLFRGLIDRQEWTDSGSVSERV
LRSYLLLFGSVRNYPPCVEKATQLFNAWRASGGHMSLPVDVTMAVFTVGARTPEGWDFLF
ERYRTSLQMSVKSRMKVAMAFSPLQGKLTRMMEQSLRGEVMKLQDLPDVLVTISRNPHGY
KLAWDFLRANWHTLIKKFDLGTSLVAYMVNGVTNQYSTTEMLDEVKLFFGSLTEETGSEM
RCIQQTYETIGDNIRWMDAHLPHLQAWLDKRSSHTVHEDL
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgttggacagcccccccctgctgctgctgctgctcctctttgcctccccatcgggagct
cagccaccaaacccagaacaacacaaggaagtgctgatatccagcagtggccagccgttt
ccctggaaccacatgagacttcccaaaacagtgtcccccctccactacgacctgggcata
caccccaacctgaccacgctcgacttcacgggagtcgtccgtatccagctgcaggtgcac
gaagacactggcgtcatcgttctccacgccaagcagatgcagatcaccgaggcgctgctc
ctggctcccgaaggcgtgcggcccctccgggttctggagtatcctcccttccatcagctc
gccctgctgtcagacaccctgctgaccagaggcaggacctacgaggtcctgctgggcttt
gctgccaccttgtccgacagcttccatgggttctacagaagcagctaccacaccagcagc
ggggccgtcagggtcctggcgtccacccagtttgaagccacctttgctcgcgcggccttc
ccctgttttgacgagccagcttttaaagccaaattcaccatcaggatcatccgggagcct
cgccacatagctgtttccaacatgcccactgtgaaaacggtggcgttgccgggcggcttg
ctggaggatcactttgacaccacggtgaaaatgagcacctacctggttgcgtacatcgtc
tccgacttcctgtctgtgagcaggaccacgcagcgtggcgtgaagatttcagtctacgcc
gtaccggagaagatcgaccagacagccttcgccctggacactgccgtcaggctcctggac
ttctacgaagactacttcgacatcccttatcctcttcccaaacaggatctggcagctatc
cccgacttccagtctggggcgatggaaaactgggggttgaccacctatcgagagacggcc
ctcctctacgatcccgacaaatcgtccccttcggataaactggccatcaccaaggtgatc
gcgcatgagctagcacaccagtggtttggaaacctggtgacgatggagtggtggaacgac
ctgtggctcaacgagggttttgccaagttcatggagttcatttccgtcaacgtcaccaac
ccagagctgcatgtggatgacttcttcttggggaaatgctttgaggccatggaggtggac
tccctcccctcctcccatcctgtctccactcacgtggagaatcccatgcagatccaggag
atctttgatgatgtctcctacgacaagggagcgtgtatcctgaatatgctgcgggacttt
gtgactcctgaggcgtttgaaatcggcatcatccgatacctcagacgcttcagctaccaa
aacaccgtcagccgacacctgtgggagagcctgacggacctctgcagcccagatcttctg
gaccaaggagacaggaaacatacggaattctgctccgctcggaaccgtccctctggagct
tccaagtggtactctggcgatgagctggacgtccaggccatcatggacacctggacactg
caagagggtttcccgctggtcactgtagaggtcagaggtcgcgaggtccggctcagccag
gagcgttacctgaagacagacgagccctccctcactgacggattcctctggcagatccct
ttgacctacgtgaccagcgcctccagcaccatccgccgcttcctcctgaagacaaagacg
gacgtcctctacctcccccaggaggtggactgggtgaagttcaacgtggacatgagtggc
tactacatggtccactacgagggcgacggctggaacgccatcatcaacctgctgcagcac
aaccacacggtgctgaccagcaacgaccgggccagcctcgtccacgacgtcttccagctg
gtcagcgtggggaaggtgaggctggacacggctctggaactgtccctgtatctgtccaga
gagacggagaccatggctgtgacccagggcttccaggagctcgtacctctgtacaagctg
atggagaagagggacatggctgctctggagaaccggatgaagagctacatcgtggatttg
ttccgcggcctgatcgatcggcaggagtggactgactccggatcagtgtcggagcgagtt
ctgaggagctacctgctgctgttcggctccgtgaggaactaccctccctgtgtggaaaaa
gccacccaactcttcaacgcgtggagggcctctggtggccacatgagcctcccggttgac
gtcaccatggcggtgtttaccgttggagcccgaacgccggaggggtgggacttcctgttt
gagagataccgcacgtccctgcagatgtccgtaaaaagccgcatgaaggtcgcgatggcg
ttcagcccgctgcagggcaagctcaccaggatgatggagcagagcctccggggcgaggtg
atgaagctgcaggacctcccggacgtgctcgtcaccatcagcaggaaccctcatggctac
aaactagcctgggacttcctgcgagccaactggcacactctgatcaagaagtttgatttg
ggcacgagcctcgtcgcctacatggtgaacggagtcaccaaccagtactccaccactgag
atgctagacgaggtgaagctcttctttggctccttaaccgaggagacgggctcggagatg
aggtgcatccagcagacctacgagaccatcggggacaacatccgctggatggacgcgcac
ctccctcatctgcaggcctggctggacaaacgcagcagccacacggtgcacgaggattta
tag

DBGET integrated database retrieval system