KEGG   Takifugu rubripes (torafugu): 101079875Help
Entry
101079875         CDS       T02386                                 

Gene name
ugt1a1
Definition
(RefSeq) UDP glucuronosyltransferase family 1 member A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00040  Pentose and glucuronate interconversions
tru00053  Ascorbate and aldarate metabolism
tru00140  Steroid hormone biosynthesis
tru00830  Retinol metabolism
tru00860  Porphyrin and chlorophyll metabolism
tru00980  Metabolism of xenobiotics by cytochrome P450
tru00982  Drug metabolism - cytochrome P450
tru00983  Drug metabolism - other enzymes
tru01100  Metabolic pathways
Module
tru_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101079875 (ugt1a1)
   00053 Ascorbate and aldarate metabolism
    101079875 (ugt1a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101079875 (ugt1a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101079875 (ugt1a1)
   00860 Porphyrin and chlorophyll metabolism
    101079875 (ugt1a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101079875 (ugt1a1)
   00982 Drug metabolism - cytochrome P450
    101079875 (ugt1a1)
   00983 Drug metabolism - other enzymes
    101079875 (ugt1a1)
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101079875 (ugt1a1)
Glycosyltransferases [BR:tru01003]
 Others
  Hydrophobic molecule
   101079875 (ugt1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_trans_4_2 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101079875
NCBI-ProteinID: XP_003962100
Position
1
AA seq 525 aa AA seqDB search
MRGSGWFPTLGLLAWFCCFGPRPVEAGKVLVLPVDGSHWLSMKILVKELVQRGHDVLVLV
PETSLLIKSSENYRTEIYQVPYSKEDLDGNFNELKDGLFDKPPTMADIFINVERLVTFTT
MQVSGCESLLRNQPLMTRLQEQGFEVVLTDPFLPCGSILSHLFNVPAVYFLRGLPCELDL
KANQCPAPPSYVPMAFSGNSDVMNFPQRVKNMLMYFVQSYMCKIIYREFDRLVTRHMSDV
QSYRELLSRGAFWLLRYDFTFEYPRPVMPNTAFIGGINCAKKAALPADLEEFVNGSGDDG
FIVFTLGSMVENMPEQKAKEFFTAFGQVPQRVLWRYNGAVPENAPKNVKVMKWLPQNDLL
AHPKAKVFITHGGTHGIYEGICNGVPMLMFPLFGDQGDNVNHLVHRGVAERLGIYDVTSE
KVVAALKKMTHDKSYKEKIVKLSQINQDRPVAPLELSVFWTEFVMRHKGAEHLRVAAHDL
NWFQYHSLDVIGFLAVVLLTVLWALLKCCSCCIRRCLRTGKKKKE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcagcgggtggtttccgacactggggctgctggcctggttctgctgcttcggg
ccgcggcccgtggaggcgggaaaggtcctggtcctgcctgtggatggaagccactggctc
agcatgaagatactggtgaaggagctggtccagaggggccacgacgtgctggtgctggtg
cctgaaaccagcctgctgatcaaaagctcagagaactacaggacggagatctaccaggtt
ccgtattccaaagaggacctggacgggaacttcaatgagctgaaggacggactcttcgac
aagcccccgacgatggcggacatattcatcaacgtggagcgcctggtgaccttcaccacc
atgcaggtgagcggctgcgagagcctgctgaggaaccagcccttgatgacccggctgcag
gagcagggcttcgaggtggtgctgaccgacccgttcctcccctgcggctccatcctgtct
cacctgttcaacgttcccgccgtgtatttcctccgcgggcttccgtgcgagctggacttg
aaggcgaaccagtgccccgcccccccctcctacgtgcccatggccttctcgggcaacagc
gacgtgatgaacttcccccagagggtgaagaacatgctgatgtacttcgtgcagtcctac
atgtgcaaaatcatctaccgcgagttcgaccggctggtcaccaggcacatgtcggacgtc
cagtcgtacagggagcttctcagtcggggggctttctggctcctgaggtacgacttcacc
ttcgagtatccccgacccgtcatgccgaacacggctttcatcggaggcatcaactgtgca
aagaaagctgcgctgccggcggacctcgaagagttcgtgaacggatcgggagacgacgga
ttcatcgtttttactttgggctccatggtggaaaacatgcccgagcagaaggccaaggag
ttcttcaccgcctttggacaggttcctcaaagggttctgtggaggtacaacggagccgtg
cctgaaaacgcacccaagaatgtcaaagtcatgaagtggctgcctcagaatgacctcttg
gcccaccccaaagccaaagtcttcatcacgcacgggggcacccacggcatctacgagggc
atctgcaacggcgtgcccatgctgatgttcccgctgttcggggaccagggcgacaacgtc
aaccacctggtgcaccgcggcgtggccgagaggctcggaatctacgacgtgacaagcgag
aaggtggtcgccgcgcttaaaaagatgacccacgacaagagttataaggagaagatcgtc
aagctgtcccagatcaaccaggaccggcccgtggccccattagaactgtctgttttctgg
accgagttcgtcatgaggcacaagggtgcagagcacctccgcgtggctgcgcacgatttg
aactggttccagtaccacagtctggacgtcatcggcttcctcgccgttgtcctcctgacc
gtcctgtgggcgctgctgaagtgctgctcgtgttgcatccgcaggtgtttaagaacgggg
aagaagaaaaaggagtag

DBGET integrated database retrieval system