KEGG   Takifugu rubripes (torafugu): 105418570Help
Entry
105418570         CDS       T02386                                 

Definition
(RefSeq) monoglyceride lipase-like
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00561  Glycerolipid metabolism
tru01100  Metabolic pathways
Module
tru_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    105418570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tru01002]
    105418570
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105418570
Peptidases [BR:tru01002]
 Serine Peptidases
  Family S33
   105418570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 105418570
NCBI-ProteinID: XP_011616621
Position
Un
AA seq 78 aa AA seqDB search
MPEPAAGPRRSPQGVPYSDLQHIVNADGLHLFCRYWEPSSPPRALVFIAHGAGEHSGPYD
ELAQRLKELSLLAFAHDH
NT seq 235 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagccggcagcaggtccgcggcggagcccgcagggagttccctacagcgacctg
cagcacatcgtcaacgccgacggactgcacctgttctgccgctactgggagcccagcagc
ccgccgagggcgttggtcttcatcgcgcacggggccggagagcattctgggccttacgac
gagctggcgcagaggctgaaggaactctccctgctggccttcgcgcacgaccacg

DBGET integrated database retrieval system