KEGG   Takifugu rubripes (torafugu): 115246413
Entry
115246413         CDS       T02386                                 

Definition
(RefSeq) uncharacterized protein LOC115246413
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
tru  Takifugu rubripes (torafugu)
Brite
KEGG Orthology (KO) [BR:tru00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tru03000]
    115246413
Transcription factors [BR:tru03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    115246413
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 115246413
NCBI-ProteinID: XP_011606039
UniProt: H2S8R6
Position
Unknown
AA seq 718 aa
PNNHHYTGINQHPPLFWRTCYIHGAHDHDPSGRLHVRGQEEEEAHPKQKPNPSNEKTNPS
KRHRDRLNAELDRLASLLPFPPDVISKLDKLSVLRLAVSYLRVKSFFQVNHDKTSRKHIS
SPAASNPDQRKESLPLGGAVNESSLLLESLTGFALVVSSDGMVFYASSTIVDYLGFHQTD
VMHQNVFDYIHIDDRQEFRRQLHWAMCPPQNQASSTHQDSQLAGGTGEDYVVSNLFHSTE
AGGIPPELSGFLNRSFIARVRCLLDSTSGFLTMQFQGRLKFLHGQKKKSASGAPMPPQLA
LFCVAVPLLLPSITEMKMKNMLLRGKNKGGGGGGGGGGFISALDHGKHGEHLHRHPFGGG
GGGGMGDVADPLLLSCPSPGASQRGHHTPWTPLSKDNLKYRPDDYYSQEEPLNYCKTSMA
PHKGVTPGLGGGWPLRPNSGPLRAGQGVGYVPSNRLNRAGHYGKPYGGRGGEVFVSKLYG
NVQIPSDPDVYCIDLVKNENGYGECYDGHPVPEMPPIKVEHDSDSENGCDVYGRAWAGRD
PEALERRYCNGGYAQTSGLHLKSEGDYYNPQYSPCQRGKAGISPPYNNNYQNYAVGGHVN
GRLLKCDKELGGDAHFSPQRLSHSDSLCSNQPINLMDSHVFAQEPHKAYAHQDYNKHAAY
EFKGHGLIHAIKREPMDSPPWSESAQNMSQSMMVAPRNIMPCVMSTGPHKSSPYVYMP
NT seq 2157 nt   +upstreamnt  +downstreamnt
cccaacaaccatcattatactggaattaaccagcacccaccgttattctggcgcacctgt
tacatccacggagcgcacgatcatgatccctccgggagactgcatgtacgcgggcaggaa
gaggaggaagcccatccaaaacagaagccgaacccttccaatgagaagaccaacccgtcc
aagcgccacagggacaggctgaacgcggagctggaccggttggccagcctgctgccgttc
cccccagatgtcatctccaagctggacaaactgtctgtactgcgccttgcagtgtcctac
ctccgcgtcaagagcttcttccaagtgaaccacgacaagacctccaggaagcacatcagc
agccctgcagcctccaaccctgatcagaggaaagagagccttcctctgggcggcgccgtg
aatgaaagcagcctcctcctggagtccctgacaggcttcgccttggtggtgagcagtgat
gggatggtcttctatgcctcctccaccatcgtggactatctgggattccatcagaccgac
gtgatgcatcagaacgtgtttgactacatccacatcgatgaccgtcaggagttcaggcgc
cagctgcactgggccatgtgtcctcctcaaaaccaggcctcatcaacgcaccaggacagc
cagctagctggagggaccggagaggactacgttgtgagcaacttgttccattctacagaa
gccggtgggattccaccagaactgtcaggcttcctcaacaggtccttcattgcccgagtc
cgatgcctcctggacagcacttctggatttttgacgatgcagttccagggtcgactgaaa
ttcctgcacggccaaaaaaagaagtcagcctccggggcgccgatgccccctcagctggct
ctgttctgcgtcgcggttcccctcctgctgccctccatcaccgagatgaaaatgaagaac
atgttactgcgtggaaagaacaagggaggaggaggaggaggaggaggaggagggttcatc
tctgctctggatcacggaaagcacggggaacatctccacagacaccccttcggtggcggc
ggcggcggcgggatgggcgatgttgcagaccctctgctcctgtcctgtccctcccctggt
gcgtcccagcgcggccatcacacaccctggaccccactctccaaagacaacctcaagtac
cgccctgatgattactacagccaggaggagccactcaattactgcaagacttccatggct
ccccataaaggcgtcaccccgggcctgggtggtggctggcctctgcggccaaactccggc
cccctcagagcgggtcagggagttggatacgtcccgtctaaccgtctgaacagagcaggt
cattatgggaaaccgtacggcggcagaggcggcgaggtgtttgtctccaaactctacggg
aacgtccagattccctcggatccggatgtctactgcatcgacctggtaaagaacgagaac
ggctacggcgaatgctacgatggccatcccgtccccgagatgccgcccattaaggtggag
cacgactcggactctgagaacggctgcgacgtgtacgggagagcctgggccggtcgcgac
ccagaggcgctggagcggcgctactgcaacggcgggtacgctcaaacctccggcctccat
ctcaagtcggagggagattactacaacccgcagtactcgccctgccagcggggcaaggcg
ggaatcagccccccctacaacaacaactaccagaactatgcagtcggcggccacgtgaac
ggacgtctgctgaagtgtgacaaagagctgggcggcgacgcccacttcagcccccagcgg
ctctcccactcggactctctatgcagcaaccagcctatcaacctcatggactcgcacgtc
ttcgcccaagagcctcacaaggcgtacgcgcaccaggactacaacaaacacgccgcctat
gagttcaaagggcacggcctgatccatgcaatcaaacgggagcccatggactcgcccccg
tggtccgagagcgcccaaaacatgagccagtccatgatggtcgccccgcggaacattatg
ccctgcgtgatgagcacgggaccccacaagtccagtccctacgtttatatgccgtga

DBGET integrated database retrieval system