KEGG   Takifugu rubripes (torafugu): 115247487Help
Entry
115247487         CDS       T02386                                 

Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00480  Glutathione metabolism
tru00590  Arachidonic acid metabolism
tru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    115247487
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    115247487
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     115247487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 115247487
NCBI-ProteinID: XP_029685140
Position
21
AA seq 169 aa AA seqDB search
MEALGGYPTRSSNPKAKKLTVLLSMTVGVGCLFLLQTQLLKPRRPSDFYSFEVKDAKGRT
VSLEKYRGKASLVVNVASYSEQTEGNYRYLQELHRELGTSHFNVLAFPCGQFGDTEPGKS
RDSEAFAKATYGVTFPFFNRIKIMGSEADGFLSSPFLSSSSRLVMLILV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggaggccttagggggctaccctaccaggtcctccaaccccaaagccaagaaactgacc
gtcctgttgagtatgacagtcggtgtggggtgcctgttcctccttcagacgcagctgctg
aagccgaggcgaccgtcggacttttattcctttgaggtgaaggacgcgaaggggaggacg
gtctctctggagaagtaccgaggaaaagcgtctttagttgtaaacgtggcgagttacagc
gagcagacggagggcaactatcggtatctgcaggagctgcaccgggagctgggcacctct
cacttcaacgtcctggcctttccttgcggtcagttcggggacacggagcccgggaaaagc
cgggacagcgaggctttcgccaaggccacctacggcgttacgttccccttcttcaacagg
atcaaaataatgggctccgaggctgatggtttcctctcctctcctttcctctcctcatca
agcagactagttatgctgattcttgtgtag

DBGET integrated database retrieval system