KEGG   Takifugu rubripes (torafugu): 115248181Help
Entry
115248181         CDS       T02386                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00030  Pentose phosphate pathway
tru00480  Glutathione metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
Module
tru_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
tru_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:tru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    115248181
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    115248181
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tru04147]
    115248181
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     115248181
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     115248181
Exosome [BR:tru04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   115248181
  Exosomal proteins of colorectal cancer cells
   115248181
  Exosomal proteins of bladder cancer cells
   115248181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N Toxin_27
Motif
Other DBs
NCBI-GeneID: 115248181
NCBI-ProteinID: XP_029687668
Position
Unknown
AA seq 510 aa AA seqDB search
MNTELLTRSEVFGQLRKELYGEKQLNDSNTHIFIILGASGDLAKKKIYPTLWWLFRDGLL
PDDTYFVGFARSDLTVEDIKTACLPHMKVTTEQNECLSMFFSKNSYVRGRYDDSSSFTQL
SLHLSSLPGGSYANRLFYLALPPTVYQQVGTNISCHCMSDRGWNRIIVEKPFGRDLQSSQ
ELSVHLSSLFKENQIYRIDHYLGKEMVQNLMVLRFGNRIFGPIWNRNNVACVVLTFKEPF
GTQGRGGYFDNFGIIRDVMQNHLLQMLCLVAMEKPPTTSPDDVRDEKVKVLKRIAPVAPT
DVVLGQYVGDPEGESHARLGYQDDPSVPEGSCTPTFATAVLYIQSERWDGVPFILRCGKA
LNERKAEVRLQFSDVPGDIFDENCQRNELVVRVQPDEAIYLKMMTKRPGIYFSPEETELD
LTYKSRYKNAKLPDAYERLILDVFCGNQMHFVRSDELREAWRIFTPLLHQIEAEKTPPFX
YFYGSRGPEAADHLAKRAGFRYKGTYNGMI
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgagctcttgactcgttctgaagtgtttggacagctcaggaaggagctctat
ggagagaagcagctcaatgactccaacacgcacatttttataatcttaggagcctctgga
gatcttgccaagaaaaagatctatccaactctatggtggttattcagagatggtctcctc
ccagatgacacctactttgttggttttgcccgatctgacctgacggtggaggacatcaag
acagcatgtctccctcatatgaaggtcaccactgagcagaatgagtgtctgtcaatgttc
ttcagtaagaactcctacgtcagaggcagatacgacgacagcagctctttcacacagctc
agtcttcacctgtcctccctgccgggaggaagttacgccaacagactcttctacctggct
ctgccgcccaccgtctaccagcaagtcggcacgaacatcagctgtcactgcatgagcgac
aggggctggaacaggataattgttgagaagccctttggtcgggacctccagagttcccaa
gagttgtcagttcatctgtcctccttatttaaagagaaccagatctatcgcattgaccac
tatctaggcaaagagatggtccagaacctcatggttctcaggtttggtaatcgcatcttt
ggacccatctggaacaggaacaatgttgcttgtgtggttctcaccttcaaggagccgttt
ggcactcagggccgtggaggatactttgataactttggtataatccgggatgtcatgcag
aatcatctcctccagatgctctgtctggttgccatggagaaacctccaactacgagtcca
gacgatgtgagggatgagaaggtgaaggtcctgaagcgtatagccccagtagctccaaca
gatgtggtcctcggccagtacgtgggggaccctgagggggagagccacgccaggctgggt
taccaggatgacccctccgtacctgaaggttcctgcacaccaacatttgctactgcggtg
ctctacatccagagtgaaagatgggatggagttccattcattctccgctgcggtaaggct
ctgaatgagcggaaggcagaggtgcgtctgcagttcagcgatgtgcctggagacatattt
gatgaaaactgccagaggaatgagctggtggtgcgcgtgcagccagatgaggccatttat
ctgaagatgatgaccaagcggcctgggatttacttcagccccgaggagacggagctcgat
ctcacttacaaaagcagatacaagaatgcaaagctccctgatgcctatgagaggctgata
ctggatgtcttctgtggaaatcagatgcattttgttcgcagtgatgaactgcgagaggcc
tggaggatcttcacccctctcctccatcaaatcgaggcagagaagacacccccattcnca
tacttctatggaagccgtggcccagaagctgcagaccatcttgcaaagagagccgggttc
cgctacaagggaacatacaacggcatgatctag

DBGET integrated database retrieval system