KEGG   Takifugu rubripes (torafugu): 115252335
Entry
115252335         CDS       T02386                                 

Gene name
apln
Definition
(RefSeq) apelin isoform X1
  KO
K05225  apelin
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04080  Neuroactive ligand-receptor interaction
tru04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    115252335 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    115252335 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 115252335
NCBI-ProteinID: XP_029703060
Position
14
AA seq 82 aa
METRSQVSPGDAQHGNNAHTPALIHTKGPMASTEHGKELEEAATVRKMVQQNPARGGQTH
RPAGWKRRRPRPRLSHKGPMPF
NT seq 249 nt   +upstreamnt  +downstreamnt
atggagacacgcagtcaggtttcaccaggagatgcgcagcatggaaacaatgcacacaca
cctgccctcatacacacaaaaggtcccatggcctccacggagcatggcaaagagctggaa
gaggcagctacggtgagaaaaatggtccagcaaaatcctgcgaggggcggtcagacccac
agaccagccggctggaagaggagacgcccacggccacgtctttcccacaaggggccaatg
ccattctag

DBGET integrated database retrieval system